Property Summary

NCBI Gene PubMed Count 23
PubMed Score 60.84
PubTator Score 55.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.200 1.4e-02
diabetes mellitus -1.100 1.9e-02
intraductal papillary-mucinous adenoma (... -1.400 1.2e-02
lung adenocarcinoma -1.200 9.5e-08
lung carcinoma -1.200 1.3e-10
malignant mesothelioma 1.100 2.5e-04
medulloblastoma 1.300 1.8e-02
medulloblastoma, large-cell 1.300 1.8e-02
non-small cell lung cancer -1.005 2.9e-13
osteosarcoma 1.522 4.2e-02
ovarian cancer -1.300 4.0e-02
pancreatic ductal adenocarcinoma liver m... -1.079 8.1e-03
pediatric high grade glioma 1.100 2.5e-02
primitive neuroectodermal tumor 1.600 8.7e-03
psoriasis 1.500 9.0e-07
subependymal giant cell astrocytoma 1.997 2.3e-02
ulcerative colitis 1.100 1.7e-05

Gene RIF (9)

AA Sequence

MAKMEVKTSLLDNMIGVGDMVLLEPLNEETFINNLKKRFDHSEIYTYIGSVVISVNPYRSLPIYSPEKVE      1 - 70
EYRNRNFYELSPHIFALSDEAYRSLRDQDKDQCILITGESGAGKTEASKLVMSYVAAVCGKGAEVNQVKE     71 - 140
QLLQSNPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDPLGGVISNYLLEKSRVVKQPRGERNFHVFYQ    141 - 210
LLSGASEELLNKLKLERDFSRYNYLSLDSAKVNGVDDAANFRTVRNAMQIVGFMDHEAESVLAVVAAVLK    211 - 280
LGNIEFKPESRVNGLDESKIKDKNELKEICELTGIDQSVLERAFSFRTVEAKQEKVSTTLNVAQAYYARD    281 - 350
ALAKNLYSRLFSWLVNRINESIKAQTKVRKKVMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTL    351 - 420
KEEQEEYIREDIEWTHIDYFNNAIICDLIENNTNGILAMLDEECLRPGTVTDETFLEKLNQVCATHQHFE    421 - 490
SRMSKCSRFLNDTSLPHSCFRIQHYAGKVLYQVEGFVDKNNDLLYRDLSQAMWKASHALIKSLFPEGNPA    491 - 560
KINLKRPPTAGSQFKASVATLMKNLQTKNPNYIRCIKPNDKKAAHIFNEALVCHQIRYLGLLENVRVRRA    561 - 630
GYAFRQAYEPCLERYKMLCKQTWPHWKGPARSGVEVLFNELEIPVEEYSFGRSKIFIRNPRTLFKLEDLR    631 - 700
KQRLEDLATLIQKIYRGWKCRTHFLLMKKSQIVIAAWYRRYAQQKRYQQTKSSALVIQSYIRGWKARKIL    701 - 770
RELKHQKRCKEAVTTIAAYWHGTQARRELRRLKEEARNKHAIAVIWAYWLGSKARRELKRLKEEARRKHA    771 - 840
VAVIWAYWLGLKVRREYRKFFRANAGKKIYEFTLQRIVQKYFLEMKNKMPSLSPIDKNWPSRPYLFLDST    841 - 910
HKELKRIFHLWRCKKYRDQFTDQQKLIYEEKLEASELFKDKKALYPSSVGQPFQGAYLEINKNPKYKKLK    911 - 980
DAIEEKIIIAEVVNKINRANGKSTSRIFLLTNNNLLLADQKSGQIKSEVPLVDVTKVSMSSQNDGFFAVH    981 - 1050
LKEGSEAASKGDFLFSSDHLIEMATKLYRTTLSQTKQKLNIEISDEFLVQFRQDKVCVKFIQGNQKNGSV   1051 - 1120
PTCKRKNNRLLEVAVP                                                         1121 - 1136
//

Text Mined References (30)

PMID Year Title