Property Summary

NCBI Gene PubMed Count 71
PubMed Score 83.78
PubTator Score 36.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Endometrial Neoplasms 55 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.4
DOID:9917 31 0.0 1.2
Endometrial cancer 311 0.0 0.8
Disease Target Count Z-score Confidence
Prostate cancer 175 4.588 2.3

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 1.3e-05
breast carcinoma 1.100 2.0e-02
colon cancer -1.200 7.9e-04
glioblastoma -1.200 2.0e-03
medulloblastoma, large-cell -1.100 6.8e-03
osteosarcoma -1.002 2.5e-04
ovarian cancer -1.600 2.5e-06
psoriasis -1.300 2.8e-04

Synonym

Accession O43791 B2R6S3 D3DTW7 Q53HJ1
Symbols TEF2
BTBD32

Gene

PDB

4EOZ   2CR2   3HQH   3HQI   3HQL   3HQM   3HSV   3HTM   3HU6   3IVB   3IVQ   3IVV   4HS2   4J8Z   4O1V  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (47)

AA Sequence

MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLR      1 - 70
VNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRD     71 - 140
FLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQE    141 - 210
FQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKY    211 - 280
ALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVA    281 - 350
EAYRSLASAQCPFLGPPRKRLKQS                                                  351 - 374
//

Text Mined References (72)

PMID Year Title