Property Summary

NCBI Gene PubMed Count 59
Grant Count 19
R01 Count 10
Funding $1,860,625.32
PubMed Score 68.39
PubTator Score 36.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.300 0.000
osteosarcoma -1.002 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.200 0.002
medulloblastoma, large-cell -1.100 0.007
colon cancer -1.200 0.001
breast carcinoma 1.100 0.020
ovarian cancer 2.200 0.000

Gene RIF (36)

PMID Text
26527005 SPOP acts as a tumor suppressor by promoting senescence through degrading SENP7.
26505385 Data indicate that a mutation in the SPOP gene may not be associated with breast cancer, particularly in Chinese women.
26344096 Overcoming ERG resistance to SPOP-mediated degradation represents a viable strategy for treatment of prostate cancers expressing either mutated SPOP or truncated ERG.
26344095 SPOP functions as a tumor suppressor to negatively regulate the stability of the ERG oncoprotein in prostate cancer.
26156804 our findings emphasize the critical role of SPOP in the regulation of proliferation and migration in liver cancer
26022775 results suggest that SPOP plays a pivotal role in colorectal cancer (CRC) through mesenchymal-epithelial transition and matrix metalloproteases.
25766326 Our study revealed novel molecular mechanisms underlying the regulation of ERa protein and provided insights in understanding the relationship between SPOP mutations and the development of endometrial cancer.
25351530 SPOP has potential use as novel biomarker of glioma and may serve as an independent predictive factor for prognosis of glioma patients.
25278611 SPOP mutants impaired ubiquitylation of a subset of proteins in a dominant-negative fashion.
25274033 studies highlight the AR axis as the key transcriptional output of SPOP in prostate adenocarcinoma and provide an explanation for the prostate-specific tumor suppressor role of wt-SPOP
More...

AA Sequence

MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLR      1 - 70
VNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRD     71 - 140
FLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQE    141 - 210
FQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKY    211 - 280
ALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVA    281 - 350
EAYRSLASAQCPFLGPPRKRLKQS                                                  351 - 374
//

Text Mined References (60)

PMID Year Title
26527005 2015 SPOP E3 Ubiquitin Ligase Adaptor Promotes Cellular Senescence by Degrading the SENP7 deSUMOylase.
26505385 2015 Relationship between SPOP mutation and breast cancer in Chinese population.
26344096 2015 Truncated ERG Oncoproteins from TMPRSS2-ERG Fusions Are Resistant to SPOP-Mediated Proteasome Degradation.
26344095 2015 SPOP Promotes Ubiquitination and Degradation of the ERG Oncoprotein to Suppress Prostate Cancer Progression.
26156804 2015 Speckle-type POZ protein is negatively associated with malignancies and inhibits cell proliferation and migration in liver cancer.
26022775 2015 Properties and Clinical Relevance of Speckle-Type POZ Protein in Human Colorectal Cancer.
25766326 2015 Endometrial cancer-associated mutants of SPOP are defective in regulating estrogen receptor-? protein turnover.
25351530 2015 Decreased expression of the SPOP gene is associated with poor prognosis in glioma.
25278611 2014 Prostate cancer. Ubiquitylome analysis identifies dysregulation of effector substrates in SPOP-mutant prostate cancer.
25274033 2014 Androgen receptor is the key transcriptional mediator of the tumor suppressor SPOP in prostate cancer.
More...