Property Summary

NCBI Gene PubMed Count 13
Grant Count 13
R01 Count 5
Funding $1,801,396.21
PubMed Score 29.13
PubTator Score 13.10

Knowledge Summary

Patent (1,347)

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -2.200 0.000
lung cancer -1.200 0.001
posterior fossa group B ependymoma 1.200 0.000
lung adenocarcinoma 1.100 0.000

Gene RIF (6)

PMID Text
23415227 Study identified the dual specificity tyrosine-phosphorylation-regulated kinase 3 (DYRK3) as a protein with the ability to condense P-granule-like speckles in the cytosol and to prevent stress granule dissolution via its N-terminal domain when it is in a kinase-inactive form.
21693704 the lipid raft-dependent endocytosis process mediates C. neoformans internalization into HBMEC and the CD44 protein of the hosts, cytoskeleton, and intracellular kinase-DYRK3 are involved in this process
20167603 DYRK1A and DYRK3 promote cell survival through phosphorylation and activation of SIRT1.
18854306 DYRK3 dual-specificity kinase attenuates erythropoiesis during anemia
15607427 DYRK3, expression is strong in erythroid cells and testis, but is also detected in adult kidney and liver
12356771 DYRK3 has roles in kinase activation, binding to CREB, and hematopoietic progenitor cell survival

AA Sequence

MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFT      1 - 70
GDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVP     71 - 140
LTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYE    141 - 210
VLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTF    211 - 280
RNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSS    281 - 350
TKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLAC    351 - 420
MMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGC    421 - 490
DDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRVVNPASAFQGLGSKLPPVVG    491 - 560
IANKLKANLMSETNGSIPLCSVLPKLIS                                              561 - 588
//

Text Mined References (16)

PMID Year Title
23415227 2013 Dual specificity kinase DYRK3 couples stress granule condensation/dissolution to mTORC1 signaling.
21693704 2011 Invasion of Cryptococcus neoformans into human brain microvascular endothelial cells is mediated through the lipid rafts-endocytic pathway via the dual specificity tyrosine phosphorylation-regulated kinase 3 (DYRK3).
20167603 2010 DYRK1A and DYRK3 promote cell survival through phosphorylation and activation of SIRT1.
18854306 2008 DYRK3 dual-specificity kinase attenuates erythropoiesis during anemia.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15607427 2005 DYRK gene structure and erythroid-restricted features of DYRK3 gene expression.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
More...