Property Summary

NCBI Gene PubMed Count 31
PubMed Score 188.71
PubTator Score 73.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carnitine-Acylcarnitine Translocase Deficiency 1 0.0 0.0

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -1.500 1.4e-03
malignant mesothelioma -2.900 3.2e-08
osteosarcoma -1.279 4.0e-03
pancreatic ductal adenocarcinoma liver m... -1.955 4.0e-03
ulcerative colitis -1.600 8.3e-08

Gene RIF (15)

AA Sequence

MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITG      1 - 70
LYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQI     71 - 140
QASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAP    141 - 210
RILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPAN    211 - 280
AACFLGFEVAMKFLNWATPNL                                                     281 - 301
//

Text Mined References (35)

PMID Year Title