Property Summary

NCBI Gene PubMed Count 18
PubMed Score 51.92
PubTator Score 24.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.400 1.5e-06
astrocytic glioma -2.000 4.8e-03
atypical teratoid/rhabdoid tumor -1.100 1.4e-06
Breast cancer 2.400 4.5e-02
ductal carcinoma in situ 1.100 9.5e-03
ependymoma -1.300 3.6e-02
glioblastoma -1.100 1.6e-06
group 4 medulloblastoma -1.700 1.5e-04
intraductal papillary-mucinous adenoma (... 1.200 3.6e-03
intraductal papillary-mucinous carcinoma... 1.100 3.3e-03
medulloblastoma, large-cell -1.100 2.6e-02
Multiple myeloma 1.934 1.7e-04
oligodendroglioma -1.300 2.6e-02
ovarian cancer 1.300 5.8e-03
primitive neuroectodermal tumor -1.100 1.3e-02
psoriasis 1.200 1.2e-34
subependymal giant cell astrocytoma -1.235 3.9e-02
Waldenstrons macroglobulinemia 1.198 1.8e-02

Gene RIF (5)

AA Sequence

MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDY      1 - 70
NMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE                        71 - 121
//

Text Mined References (27)

PMID Year Title