Property Summary

NCBI Gene PubMed Count 59
Grant Count 25
R01 Count 10
Funding $2,018,821.63
PubMed Score 231.14
PubTator Score 45.08

Knowledge Summary

Patent

No data available

Expression

Gene RIF (41)

PMID Text
26169395 the binding of SGTA to Rpn13 enables specific polypeptides to escape proteasomal degradation and/or selectively modulates substrate degradation.
25415308 Data show that molecular chaperone BAG6_ubiquitin-like domain (UBL) and ubiquitin-like 4A UBL4A_UBL compete for the same binding site on N-terminal dimerisation domain of SGTA protein (SGTA_NT).
25179605 data suggest that SGTA regulates the cellular fate of a range of hydrophobic polypeptides should they become exposed to the cytosol.
25027991 SGTA overexpression may be involved in the pathogenesis of breast cancer which might serve as a future target for novel treatment in breast cancer.
24974147 A role of SGTA in Non-Hodgkin's lymphoma (NHL) cell proliferation, adhesion and drug resistance, and it may pave the way for a novel therapeutic approach for cell adhesion-mediated drug resistance in NHL.
24753260 Our data suggest a role for SGTA at distinct steps in the chaperone-dependent modulation of androgen, glucocorticoid, and progesterone receptor activity.
24195513 Univariate analysis showed that the low SGTB expression was associated with poor prognosis (P<0.001)
23939810 High expression of SGTA in esophageal squamous cell carcinoma correlates with proliferation and poor prognosis.
23857189 High Small glutamine-rich tetratricopeptide repeat-containing protein alpha expression is associated with non-small-cell lung cancer tumorigenesis.
23839012 SGTA depletion decreased cyclin A and cyclin B levels.
More...

AA Sequence

MDNKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPEIFEAAATGKE      1 - 70
MPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGN     71 - 140
YAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIAELKLREAP    141 - 210
SPTGGVGSFDIAGLLNNPGFMSMASNLMNNPQIQQLMSGMISGGNNPLGTPGTSPSQNDLASLIQAGQQF    211 - 280
AQQMQQQNPELIEQLRSQIRSRTPSASNDDQQE                                         281 - 313
//

Text Mined References (69)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26169395 2015 Binding of SGTA to Rpn13 selectively modulates protein quality control.
25416956 2014 A proteome-scale map of the human interactome network.
25415308 2014 Solution structure of the SGTA dimerisation domain and investigation of its interactions with the ubiquitin-like domains of BAG6 and UBL4A.
25179605 2014 SGTA regulates the cytosolic quality control of hydrophobic substrates.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
25027991 2014 Expression and prognostic role of SGTA in human breast carcinoma correlates with tumor cell proliferation.
24974147 2014 Expression of small glutamine-rich TPR-containing protein A (SGTA) in Non-Hodgkin's Lymphomas promotes tumor proliferation and reverses cell adhesion-mediated drug resistance (CAM-DR).
24753260 2014 The cochaperone SGTA (small glutamine-rich tetratricopeptide repeat-containing protein alpha) demonstrates regulatory specificity for the androgen, glucocorticoid, and progesterone receptors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...