Property Summary

NCBI Gene PubMed Count 14
PubMed Score 155.77
PubTator Score 141.57

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

AA Sequence

MEPGMLGPHNLPHHEPISFGIDQILSGPETPGGGLGLGRGGQGHGENGAFSGGYHGASGYGPAGSLAPLP      1 - 70
GSSGVGPGGVIRVPAHRPLPVPPPAGGAPAVPGPSGLGGAGGLAGLTFPWMDSGRRFAKDRLTAALSPFS     71 - 140
GTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRT    141 - 210
KWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGL    211 - 280
ASVV                                                                      281 - 284
//

Text Mined References (17)

PMID Year Title