Property Summary

NCBI Gene PubMed Count 13
Grant Count 9
R01 Count 9
Funding $1,131,903.6
PubMed Score 152.77
PubTator Score 141.57

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
20728215 NCX-TRPC channel interaction constitutes an important functional unit in receptor-mediated divalent calcium ion influx in neuronal cells.
20044949 TLX2 is an orphan homeodomain transcription factor whose expression is mainly associated with tissues derived from neural crest cells.
19719399 NCX is functionally expressed in developing ventricular human embryonic stem cell-derived ventricular cardiomyocytes and contributes to their excitation-contraction coupling.
16969514 Hox11L1 has a role in tumorigenesis in gastrointestinal stromal tumors
16402914 These results support the PHOX2B-TLX2 promoter interaction, suggesting a physiological role in the transcription-factor cascade underlying the differentiation of neuronal lineages of the Autonomic Nervous System during human embryogenesis.
16291166 Alignment of sequences obtained from rat, human, and mouse indicates that putative regulatory elements of the Hox11L1 gene are conserved in rat, mice, and humans.
10446220 This paper describes sequencing and comparison of 5' flanking regions of the gene, and expression in several neuroblastoma cell lines, in both mouse and human.

AA Sequence

MEPGMLGPHNLPHHEPISFGIDQILSGPETPGGGLGLGRGGQGHGENGAFSGGYHGASGYGPAGSLAPLP      1 - 70
GSSGVGPGGVIRVPAHRPLPVPPPAGGAPAVPGPSGLGGAGGLAGLTFPWMDSGRRFAKDRLTAALSPFS     71 - 140
GTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRT    141 - 210
KWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGL    211 - 280
ASVV                                                                      281 - 284
//

Text Mined References (16)

PMID Year Title
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
20728215 Selective interference with TRPC3/6 channels disrupts OX1 receptor signalling via NCX and reveals a distinct calcium influx pathway.
20389279 2010 Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless.
20044949 2009 Functional characterization of a minimal sequence essential for the expression of human TLX2 gene.
19719399 2010 Na+/Ca2+ exchanger is a determinant of excitation-contraction coupling in human embryonic stem cell-derived ventricular cardiomyocytes.
16969514 2006 Allelic loss of Hox11L1 gene locus predicts outcome of gastrointestinal stromal tumors.
16402914 2006 The TLX2 homeobox gene is a transcriptional target of PHOX2B in neural-crest-derived cells.
16291166 2005 Evaluation of Hox11L1 in the fmc/fmc rat model of chronic intestinal pseudo-obstruction.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...