Property Summary

NCBI Gene PubMed Count 7
Grant Count 12
R01 Count 9
Funding $1,181,821.68
PubMed Score 2.42
PubTator Score 2.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (2)

PMID Text
19357284 This study demonstrates the interaction of the mouse homolog, synaptogyrin 3, with the dopamine transporter (DAT).
14755516 This study identifies the mouse homolog, synaptogyrin 3, as a synaptic vesicle protein.

AA Sequence

MEGASFGAGRAGAALDPVSFARRPQTLLRVASWVFSIAVFGPIVNEGYVNTDSGPELRCVFNGNAGACRF      1 - 70
GVALGLGAFLACAAFLLLDVRFQQISSVRDRRRAVLLDLGFSGLWSFLWFVGFCFLTNQWQRTAPGPATT     71 - 140
QAGDAARAAIAFSFFSILSWVALTVKALQRFRLGTDMSLFATEQLSTGASQAYPGYPVGSGVEGTETYQS    141 - 210
PPFTETLDTSPKGYQVPAY                                                       211 - 229
//

Text Mined References (10)

PMID Year Title
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
20224928 2011 Identification of genes associated with chemosensitivity to SAHA/taxane combination treatment in taxane-resistant breast cancer cells.
19357284 2009 Physical and functional interaction between the dopamine transporter and the synaptic vesicle protein synaptogyrin-3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14755516 2004 Characterization of synaptogyrin 3 as a new synaptic vesicle protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9760194 1998 Characterization of the human synaptogyrin gene family.