Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.42
PubTator Score 2.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 8.98540582678068E-16
posterior fossa group B ependymoma 1530 1.48163897636558E-15
pilocytic astrocytoma 3086 1.71080907185873E-11
group 4 medulloblastoma 1875 2.11141191302512E-9
atypical teratoid / rhabdoid tumor 4369 7.73106206587244E-9
adult high grade glioma 2148 1.77801277060502E-7
tuberculosis 1563 3.12336555047193E-7
non-small cell lung cancer 2798 3.77134951166991E-7
medulloblastoma, large-cell 6234 2.05668092170798E-6
glioblastoma 5572 1.01790300655192E-5
astrocytoma 1493 0.0011302504848447
Breast cancer 3099 0.00124533371442188
invasive ductal carcinoma 2950 0.00159616245453294
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0159480510028183
Pick disease 1893 0.0205040542566111
primitive neuroectodermal tumor 3031 0.0238235724810784
severe Alzheimer's disease 49 0.0302845121321101
spina bifida 1064 0.0366642971409801

Expression

  Differential Expression (18)

Synonym

Accession O43761 B2R9S0
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (2)

PMID Text
19357284 This study demonstrates the interaction of the mouse homolog, synaptogyrin 3, with the dopamine transporter (DAT).
14755516 This study identifies the mouse homolog, synaptogyrin 3, as a synaptic vesicle protein.

AA Sequence

MEGASFGAGRAGAALDPVSFARRPQTLLRVASWVFSIAVFGPIVNEGYVNTDSGPELRCVFNGNAGACRF      1 - 70
GVALGLGAFLACAAFLLLDVRFQQISSVRDRRRAVLLDLGFSGLWSFLWFVGFCFLTNQWQRTAPGPATT     71 - 140
QAGDAARAAIAFSFFSILSWVALTVKALQRFRLGTDMSLFATEQLSTGASQAYPGYPVGSGVEGTETYQS    141 - 210
PPFTETLDTSPKGYQVPAY                                                       211 - 229
//

Text Mined References (10)

PMID Year Title
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
20224928 2011 Identification of genes associated with chemosensitivity to SAHA/taxane combination treatment in taxane-resistant breast cancer cells.
19357284 2009 Physical and functional interaction between the dopamine transporter and the synaptic vesicle protein synaptogyrin-3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14755516 2004 Characterization of synaptogyrin 3 as a new synaptic vesicle protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9760194 1998 Characterization of the human synaptogyrin gene family.