Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.59
PubTator Score 11.80

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
22675529 SYNGR1 was soluble and stable in a variety of mild detergents and multiple biophysical methods confirmed the folded state of the protein.
19665806 A case-control study with synaptogyrin 1 was conducted in 506 bipolar disorder patients and 507 healthy individuals from the Han Chinese population. No association was found in this study.
19665806 Observational study of gene-disease association. (HuGE Navigator)
19641478 The results of association study support a contribution of SYNGR1 to schizophrenia susceptibility.
19641478 Observational study of gene-disease association. (HuGE Navigator)
17049558 These mutations were not found in 507 control subjects, suggesting further functional assays are warranted to verify their relevance to the pathogenesis of schizophrenia.
16215643 Observational study of gene-disease association. (HuGE Navigator)
16215643 Our results support SYNGR1 as a probable susceptibility gene for schizophrenia and bipolar disorder.
14732601 This research found a novel nonsense mutation (Trp27Ter) in exon 2 of the SYNGR1 gene in a family multiply affected with schizophrenia. And expressed in the brain.

AA Sequence

MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSY      1 - 70
GVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPL     71 - 140
NEGTDAARAAIAFSFFSIFTWAGQAVLAFQRYQIGADSALFSQDYMDPSQDSSMPYAPYVEPTGPDPAGM    141 - 210
GGTYQQPANTFDTEPQGYQSQGY                                                   211 - 233
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22675529 2012 Optimisation of over-expression in E. coli and biophysical characterisation of human membrane protein synaptogyrin 1.
19665806 2009 No association between bipolar disorder and syngr1 or synapsin II polymorphisms in the Han Chinese population.
19641478 2009 Association study and mutational screening of SYNGR1 as a candidate susceptibility gene for schizophrenia.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
17049558 2007 Identification of rare mutations of synaptogyrin 1 gene in patients with schizophrenia.
More...