Property Summary

NCBI Gene PubMed Count 19
PubMed Score 8.64
PubTator Score 11.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -2.200 2.2e-06
astrocytic glioma -1.200 2.2e-03
Astrocytoma, Pilocytic -1.500 1.3e-08
atypical teratoid / rhabdoid tumor -2.900 2.9e-14
cutaneous lupus erythematosus -1.200 4.4e-03
ependymoma -1.700 9.4e-03
esophageal adenocarcinoma -1.700 1.8e-02
glioblastoma -2.300 9.3e-12
group 3 medulloblastoma -1.300 3.2e-03
interstitial cystitis -1.100 5.9e-04
intraductal papillary-mucinous adenoma (... -2.400 1.1e-05
intraductal papillary-mucinous carcinoma... -2.000 3.1e-04
intraductal papillary-mucinous neoplasm ... -2.100 2.5e-03
medulloblastoma, large-cell -2.200 2.4e-05
nasopharyngeal carcinoma -1.100 1.4e-03
oligodendroglioma -1.600 2.5e-20
osteosarcoma -2.592 2.8e-05
ovarian cancer -1.900 8.8e-09
Pick disease -1.400 1.7e-03
pituitary cancer 1.800 1.7e-07
primitive neuroectodermal tumor -1.500 1.5e-04
psoriasis -1.100 3.4e-11
spina bifida -1.130 3.6e-02
subependymal giant cell astrocytoma -2.928 2.1e-02
urothelial carcinoma -1.100 9.5e-03

Gene RIF (9)

AA Sequence

MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSY      1 - 70
GVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPL     71 - 140
NEGTDAARAAIAFSFFSIFTWAGQAVLAFQRYQIGADSALFSQDYMDPSQDSSMPYAPYVEPTGPDPAGM    141 - 210
GGTYQQPANTFDTEPQGYQSQGY                                                   211 - 233
//

Text Mined References (21)

PMID Year Title