Property Summary

NCBI Gene PubMed Count 48
Grant Count 31
R01 Count 20
Funding $2,252,371.01
PubMed Score 53.12
PubTator Score 44.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 1.200 0.002
osteosarcoma -1.170 0.000
tuberculosis and treatment for 6 months -1.300 0.000
non-small cell lung cancer 1.062 0.000
Breast cancer 3.000 0.022
group 4 medulloblastoma 1.400 0.000
breast carcinoma 1.100 0.000
ductal carcinoma in situ 1.400 0.001
invasive ductal carcinoma 1.600 0.007
ovarian cancer 1.500 0.004

Gene RIF (17)

PMID Text
26906622 the expression of STX6 was up-regulated in esophageal squamous cell carcinoma samples, and its expression was significantly correlated with tumor size, histological differentiation, lymph node metastasis and depth
25496667 Genome-wide shRNA screening identifies STX6, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24746815 The compartment-specific interaction of Syntaxin 6 with v-SNARES VAMP3 and VAMP4 are controlled through an ability of Syntaxin 6 to sense cholesterol levels in the trans-Golgi network and recycling endosomes.
23932592 A dityrosine motif of Ang2 interacts with a highly conserved groove in Syntaxin 6.
23818989 Data indicate that E3 ubiquitin ligase MARCH2 co-immunoprecipitated and co-localized with CAL and syntaxin 6 (STX6), and show the ubiquitination of CFTR by MARCH2.
23798538 Syntaxin 6 and VAMP4 colocalize to the chlamydial inclusion.
23677696 Data indicate that depletion of VAMP4, syntaxin 6, syntaxin 16, and Vti1a disrupted the Golgi ribbon structure.
23585472 colocalization of ATP11B with fluorescent cisplatin and with vesicular trafficking proteins, such as STX6 and VAMP4, strongly suggests that ATP11B contributes to secretory vesicular transport of cisplatin from Golgi to plasma membrane
23415606 No pathogenic mutations are found in syntaxin 6 that are associated with risk of Parkinson's disease.
22573826 Data suggest a new integrin trafficking pathway in which endocytosed integrins are transported from VAMP3-containing recycling endosomes to STX6-containing trans-Golgi network before being recycled to the plasma membrane.
More...

AA Sequence

MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDLDETISI      1 - 70
VEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTSSVQALAERKNRQALLGDSGSQNWSTGTTDKY     71 - 140
GRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELES    141 - 210
TQSRLDNVMKKLAKVSHMTSDRRQWCAIAILFAVLLVVLILFLVL                             211 - 255
//

Text Mined References (53)

PMID Year Title
26906622 2016 Essential role of STX6 in esophageal squamous cell carcinoma growth and migration.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25799061 2015 EARP is a multisubunit tethering complex involved in endocytic recycling.
25416956 2014 A proteome-scale map of the human interactome network.
24746815 2014 Cholesterol regulates Syntaxin 6 trafficking at trans-Golgi network endosomal boundaries.
23932592 2013 Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6.
23818989 2013 Ubiquitination and degradation of CFTR by the E3 ubiquitin ligase MARCH2 through its association with adaptor proteins CAL and STX6.
23798538 2013 Vesicle-associated membrane protein 4 and syntaxin 6 interactions at the chlamydial inclusion.
23677696 2013 VAMP4 is required to maintain the ribbon structure of the Golgi apparatus.
23585472 2013 ATP11B mediates platinum resistance in ovarian cancer.
More...