Property Summary

NCBI Gene PubMed Count 52
PubMed Score 56.60
PubTator Score 44.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer 3.000 2.2e-02
breast carcinoma 1.100 4.0e-26
ductal carcinoma in situ 1.400 8.2e-04
group 4 medulloblastoma 1.400 3.3e-04
invasive ductal carcinoma 1.600 7.0e-03
non-small cell lung cancer 1.062 3.4e-14
osteosarcoma -1.170 3.5e-04
ovarian cancer 1.500 3.6e-03
psoriasis 1.200 1.9e-03
tuberculosis and treatment for 3 months -1.200 5.8e-04

Gene RIF (19)

AA Sequence

MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDLDETISI      1 - 70
VEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTSSVQALAERKNRQALLGDSGSQNWSTGTTDKY     71 - 140
GRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELES    141 - 210
TQSRLDNVMKKLAKVSHMTSDRRQWCAIAILFAVLLVVLILFLVL                             211 - 255
//

Text Mined References (57)

PMID Year Title