Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.11
PubTator Score 1.10

Knowledge Summary

Patent (6,719)

TINX Plot

  Disease Relevance (4)

AA Sequence

MSGTNQSSVSEFLLLGLSRQPQQQHLLFVFFLSMYLATVLGNLLIILSVSIDSCLHTPMYFFLSNLSFVD      1 - 70
ICFSFTTVPKMLANHILETQTISFCGCLTQMYFVFMFVDMDNFLLAVMAYDHFVAVCHPLHYTAKMTHQL     71 - 140
CALLVAGLWVVANLNVLLHTLLMAPLSFCADNAITHFFCDVTPLLKLSCSDTHLNEVIILSEGALVMITP    141 - 210
FLCILASYMHITCTVLKVPSTKGRWKAFSTCGSHLAVVLLFYSTIIAVYFNPLSSHSAEKDTMATVLYTV    211 - 280
VTPMLNPFIYSLRNRYLKGALKKVVGRVVFSV                                          281 - 312
//

Text Mined References (7)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
9653642 1998 A transcriptional Map of the FMF region.
9500546 1998 Distribution of olfactory receptor genes in the human genome.
9288094 1997 A candidate gene for familial Mediterranean fever.