Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.73
PubTator Score 5.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ulcerative colitis 2087 4.47508353576145E-7
osteosarcoma 7933 5.77935627669662E-7
interstitial cystitis 2299 1.32435069653424E-4
psoriasis 6685 1.99212990919544E-4
colon cancer 1475 6.54194428460233E-4
cutaneous lupus erythematosus 1056 0.00257023394756524
Atopic dermatitis 944 0.00267932983340371
head and neck cancer and chronic obstructive pulmonary disease 237 0.00804215953904948
active Crohn's disease 918 0.011470776857909

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -2.100 0.000
cutaneous lupus erythematosus -2.900 0.003
osteosarcoma 1.176 0.000
Atopic dermatitis -1.200 0.003
colon cancer -3.900 0.001
active Crohn's disease -2.490 0.011
ulcerative colitis -3.800 0.000
interstitial cystitis -3.300 0.000
head and neck cancer and chronic obstruc... -2.000 0.008

Synonym

Accession O43745 A8K2I8
Symbols

Gene

PDB

2BEC  

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

 IMPC Term (1)

Pathway (1)

Gene RIF (3)

PMID Text
18718049 chp2 expression in leukemia primary cells and leukemia cell lines is significantly increased.
17708351 overexpression of the CHP2 gene affects the biological behavior of ovarian cancer cell line OVCAR3 and is one of key mechanisms for ovarian carcinoma progression
16710297 These findings suggest that CHP serves as an obligatory subunit that is required both for supporting the basic activity and regulating the pH-sensing of NHE1 via interactions between distinct parts of these proteins.

AA Sequence

MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVNPLGDRIIESF      1 - 70
FPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQVL     71 - 140
RLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILK                  141 - 196
//

Text Mined References (15)

PMID Year Title
22189947 2012 Calcineurin homologous protein: a multifunctional Ca2+-binding protein family.
21507922 2011 Duffy-null-associated low neutrophil counts influence HIV-1 susceptibility in high-risk South African black women.
21392185 2011 Nuclear accumulation of calcineurin B homologous protein 2 (CHP2) results in enhanced proliferation of tumor cells.
18815128 2008 CHP2 activates the calcineurin/nuclear factor of activated T cells signaling pathway and enhances the oncogenic potential of HEK293 cells.
18718049 2008 [Expression of a tumor related gene chp2 in leukemia cells].
17708351 Overexpression of CHP2 enhances tumor cell growth, invasion and metastasis in ovarian cancer.
16710297 2006 Crystal structure of CHP2 complexed with NHE1-cytosolic region and an implication for pH regulation.
16541075 2006 The finished DNA sequence of human chromosome 12.
16511206 2005 Crystallization and preliminary crystallographic analysis of the human calcineurin homologous protein CHP2 bound to the cytoplasmic region of the Na+/H+ exchanger NHE1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...