Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.83
PubTator Score 5.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease -2.490 1.1e-02
active ulcerative colitis -1.943 1.9e-03
Atopic dermatitis -1.200 2.7e-03
colon cancer -3.900 6.5e-04
cutaneous lupus erythematosus -2.900 2.6e-03
head and neck cancer and chronic obstruc... -2.000 8.0e-03
interstitial cystitis -2.600 2.3e-03
osteosarcoma 1.176 5.8e-07
psoriasis -2.000 4.2e-07

Gene RIF (4)

AA Sequence

MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVNPLGDRIIESF      1 - 70
FPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQVL     71 - 140
RLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILK                  141 - 196
//

Text Mined References (16)

PMID Year Title