Property Summary

NCBI Gene PubMed Count 46
PubMed Score 5.30
PubTator Score 5.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 1.7852362267076E-6
pituitary cancer 1972 8.14337417771908E-5
ovarian cancer 8492 2.94287463922396E-4
medulloblastoma, large-cell 6234 2.95697886497237E-4
Pick disease 1893 3.59145986957562E-4
adrenocortical carcinoma 1427 0.00135157856281527
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00175391992772555
glioblastoma 5572 0.00268800281985067
interstitial lung disease 292 0.00343403333516045
primitive neuroectodermal tumor 3031 0.00509640792577874
lung cancer 4473 0.00776550424665222
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0473574071386084
Disease Target Count Z-score Confidence
thrombocytopenia-absent radius syndrome 15 0.0 5.0
Disease Target Count Z-score Confidence
Atrioventricular septal defect 14 3.211 1.6

Expression

  Differential Expression (12)

Synonym

Gene

PANTHER Protein Class (2)

PDB

4RER   4REW   2F15   2V8Q   2V92   2V9J   2Y8L   2Y8Q   2YA3   4CFH   4EAI   4EAJ  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA EggNOG

Gene RIF (19)

PMID Text
23552691 Sumoylation of AMPKbeta2 subunit enhances AMP-activated protein kinase activity.
22935535 Studies suggest insights into the regulation of AMPK, its diverse biological actions, and therapeutic potential in the heart.
22897928 Data indicate that except AMPK-alpha1, expressions of the other five AMPK subunits -alpha2, -beta1, -beta2, -gamma1 and -gamma2 are significantly higher in ovarian carcinomas.
22305490 results of this study demonistrated that the novel findings that intronic SNPs in the genes coding for the regulatory beta2(PRKAB2) of AMPK are associated with antipsychotic-induced weight gain in schizophrenia or schizoaffective disorder patients
21651489 Knockdown of SIRT1 by its inhibitor or siRNA results in Tat-mediated reduction of phosphorylation of AMP-activated protein kinase (AMPK) and downstream acetyl-CoA carboxylase (ACC)
21344388 Knockdown of SIRT1 by its inhibitor or siRNA results in Tat-mediated reduction of phosphorylation of AMP-activated protein kinase (AMPK) and downstream acetyl-CoA carboxylase (ACC)
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20534808 These results suggest that the modification introduced by the laforin-malin complex could affect the subcellular distribution of AMPK beta subunits.
20392842 Knockdown of SIRT1 by its inhibitor or siRNA results in Tat-mediated reduction of phosphorylation of AMP-activated protein kinase (AMPK) and downstream acetyl-CoA carboxylase (ACC)
More...

AA Sequence

MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSV      1 - 70
KPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEP     71 - 140
VVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPP    141 - 210
HLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI            211 - 272
//

Text Mined References (60)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25416956 2014 A proteome-scale map of the human interactome network.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23552691 2013 Sumoylation of AMPK?2 subunit enhances AMP-activated protein kinase activity.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22935535 2012 AMP-activated protein kinase regulation and biological actions in the heart.
22897928 2012 Over-expressions of AMPK subunits in ovarian carcinomas with significant clinical implications.
More...