Property Summary

Ligand Count 1
NCBI Gene PubMed Count 46
PubMed Score 5.52
PubTator Score 5.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma 1.507 1.4e-03
autosomal dominant Emery-Dreifuss muscul... -1.023 1.8e-03
glioblastoma 1.200 2.7e-03
interstitial lung disease 1.200 3.4e-03
lung cancer 1.700 7.8e-03
medulloblastoma, large-cell 1.300 3.0e-04
osteosarcoma 2.620 1.8e-06
ovarian cancer -1.600 6.3e-07
pancreatic ductal adenocarcinoma liver m... -1.134 4.7e-02
Pick disease -1.400 3.6e-04
pituitary cancer 1.400 8.1e-05
primitive neuroectodermal tumor 1.100 5.1e-03

Protein-protein Interaction (11)

PDB (12)

Gene RIF (19)

AA Sequence

MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSV      1 - 70
KPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEP     71 - 140
VVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPP    141 - 210
HLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI            211 - 272
//

Text Mined References (60)

PMID Year Title