Property Summary

NCBI Gene PubMed Count 23
PubMed Score 17.34
PubTator Score 6.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.405 4.1e-02
adrenocortical carcinoma -1.478 7.6e-03
Astrocytoma, Pilocytic 1.200 1.7e-03
autosomal dominant Emery-Dreifuss muscul... 1.446 3.1e-02
Breast cancer -3.500 4.1e-19
breast carcinoma -1.700 8.3e-05
colon cancer -2.300 1.3e-02
Duchenne muscular dystrophy 1.636 9.0e-05
ductal carcinoma in situ -1.300 1.2e-02
intraductal papillary-mucinous neoplasm ... -1.800 4.9e-02
invasive ductal carcinoma -1.966 1.1e-04
lung adenocarcinoma -1.400 9.7e-11
lung cancer -2.400 1.1e-04
lung carcinoma -1.500 5.0e-08
medulloblastoma, large-cell -1.800 1.3e-04
mucosa-associated lymphoid tissue lympho... -1.065 1.4e-02
Multiple myeloma 1.836 2.3e-02
non-small cell lung cancer -2.316 1.4e-17
ovarian cancer -3.300 1.6e-09
pituitary cancer -1.900 1.4e-04
psoriasis -2.100 6.2e-08
sarcoidosis 1.600 3.7e-03
severe Alzheimer's disease -1.108 3.4e-02
ulcerative colitis -1.125 1.4e-02

Gene RIF (6)

AA Sequence

MVKIAFNTPTAVQKEEARQDVEALLSRTVRTQILTGKELRVATQEKEGSSGRCMLTLLGLSFILAGLIVG      1 - 70
GACIYKYFMPKSTIYRGEMCFFDSEDPANSLRGGEPNFLPVTEEADIREDDNIAIIDVPVPSFSDSDPAA     71 - 140
IIHDFEKGMTAYLDLLLGNCYLMPLNTSIVMPPKNLVELFGKLASGRYLPQTYVVREDLVAVEEIRDVSN    141 - 210
LGIFIYQLCNNRKSFRLRRRDLLLGFNKRAIDKCWKIRHFPNEFIVETKICQE                     211 - 263
//

Text Mined References (24)

PMID Year Title