Property Summary

NCBI Gene PubMed Count 22
Grant Count 2
Funding $173,790
PubMed Score 16.63
PubTator Score 6.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Synonym

Accession O43736 B2R7X5 B4E062 Q6IBC9
Symbols E25A
BRICD2A

Gene

 Grant Application (2)

Gene RIF (5)

PMID Text
26691219 ITM2A is a new biomarker of poor prognosis in ovarian cancer and a novel tumor suppressor that induces cell cycle arrest, acts as a chemosensitizer, and has therapeutic potential for ovarian cancer.
26125709 The upregulated gene with the largest effect size in ankylosing spondylitis was ITM2A, which plays a role in activation of T cells. (Meta-analysis)
25951193 ITM2A expression is positively regulated by PKA-CREB signaling and ITM2A expression interferes with autophagic flux by interacting with vacuolar ATPase.
24516404 our results show one of the first links between phenotypic variation in a population sample and an XCI-escaping locus and pinpoint ITM2A as a potential contributor to the sexual dimorphism in height
19541402 Enhanced ITM2A expression inhibits chondrogenic differentiation of mesenchymal stem cells.

AA Sequence

MVKIAFNTPTAVQKEEARQDVEALLSRTVRTQILTGKELRVATQEKEGSSGRCMLTLLGLSFILAGLIVG      1 - 70
GACIYKYFMPKSTIYRGEMCFFDSEDPANSLRGGEPNFLPVTEEADIREDDNIAIIDVPVPSFSDSDPAA     71 - 140
IIHDFEKGMTAYLDLLLGNCYLMPLNTSIVMPPKNLVELFGKLASGRYLPQTYVVREDLVAVEEIRDVSN    141 - 210
LGIFIYQLCNNRKSFRLRRRDLLLGFNKRAIDKCWKIRHFPNEFIVETKICQE                     211 - 263
//

Text Mined References (23)

PMID Year Title
26691219 2016 Loss of ITM2A, a novel tumor suppressor of ovarian cancer through G2/M cell cycle arrest, is a poor prognostic factor of epithelial ovarian cancer.
26125709 2015 Meta-analysis of differentially expressed genes in ankylosing spondylitis.
25951193 2015 The integral membrane protein ITM2A, a transcriptional target of PKA-CREB, regulates autophagic flux via interaction with the vacuolar ATPase.
25416956 2014 A proteome-scale map of the human interactome network.
24516404 2014 Chromosome X-wide association study identifies Loci for fasting insulin and height and evidence for incomplete dosage compensation.
23612905 2013 Robust evidence for five new Graves' disease risk loci from a staged genome-wide association analysis.
19541402 Enhanced ITM2A expression inhibits chondrogenic differentiation of mesenchymal stem cells.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...