Property Summary

NCBI Gene PubMed Count 47
PubMed Score 63.95
PubTator Score 116.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
osteosarcoma 7933 1.21628783740654E-10
malignant mesothelioma 3163 5.08139436646908E-9
acute quadriplegic myopathy 1157 2.30227389721664E-8
ovarian cancer 8492 4.22503443476008E-7
pilocytic astrocytoma 3086 1.99143561708008E-6
ulcerative colitis 2087 1.61704564563957E-5
posterior fossa group A ependymoma 1511 2.71199140564192E-5
lung cancer 4473 1.37187797502954E-4
astrocytoma 1493 0.00126390043365254
glioblastoma 5572 0.0110227764730745
spina bifida 1064 0.0370305573886606
Disease Target Count Z-score Confidence
psoriasis 6685 4.483 2.2
Crohn's disease 304 0.0 2.0
Disease Target Count Z-score Confidence
Psoriatic arthritis 85 4.275 2.1
Disease Target Count Z-score Confidence
Hypertensive heart disease 3 3.291 1.6
Disease Target Count
Psoriasis 13 1

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis -2.100 0.000
malignant mesothelioma -5.800 0.000
astrocytoma 1.400 0.001
osteosarcoma -3.161 0.000
glioblastoma 1.400 0.011
acute quadriplegic myopathy 1.140 0.000
lung cancer -2.700 0.000
pilocytic astrocytoma 1.600 0.000
posterior fossa group A ependymoma 1.100 0.000
spina bifida -1.508 0.037
ulcerative colitis -1.100 0.000
ovarian cancer -1.200 0.000

Synonym

Accession O43734 B2RAY9 E1P555 Q5R3A3 Q7Z6Q1 Q7Z6Q2 Q7Z6Q3 Q9H5W2 Q9H6Y3 Q9NS14 Q9UG72
Symbols ACT1
CIKS
C6orf2
C6orf4
C6orf5
C6orf6
CANDF8
PSORS13

Gene

  Ortholog (12)

Gene RIF (33)

PMID Text
26558270 A G/G genotype of rs766748 in IL-17F, and a C/C or C/A genotype of rs1883136 in TRAF3IP2.
26376209 The suppressive effects of miR-30a were mediated by directly targeting Traf3ip2 mRNA
26148936 TRAF3IP2 may play a causal role in aldosterone-induced adverse cardiac remodeling in vivo.
25775161 A variant (rs76228616 SNP) in TRAF3IP2 gene could be involved in susceptibility to Steven-Johnson Syndrome.
25202827 identify Syk as an upstream signaling molecule in IL-17A-induced Act1-TRAF6 interaction in keratinocytes, and inhibition of Syk can attenuate CCL20 production
25024377 this study demonstrated that although ACT1-v2-D10N is nonfunctional, ACT1-v1-D19N retains the ability to interact with Hsp90 and is fully responsive to IL-17A stimulation.
25014791 Single nucleotide polymorphisms in RBPJ, IL1R1, REV3L, TRAF3IP2, IRF1 and ICOS showed association with rheumatoid arthritis in black South Africans.
24561578 These results indicate that oxLDL-induced endothelial cell death and dysfunction are mediated via TRAF3IP2 and that native HDL3 and the AMPK activators inhibit this response.
24416204 This study provides evidence that TRAF5 and TRAF3IP2 genes are involved in the development ofBehcet's disease (BD) and Vogt-Koyanagi-Harada (VKH) syndrome.
24373565 Genetic polymorphism in the TRAF3IP2 gene is associated with psoriasis vulgaris in a Japanese population.
More...

AA Sequence

MPPQLQETRMNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFS      1 - 70
QAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQF     71 - 140
SFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDS    141 - 210
QPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSP    211 - 280
DHQVPYGHDYPRAAYQQVIQPALPGQPLPGASVRGLHPVQKVILNYPSPWDHEERPAQRDCSFPGLPRHQ    281 - 350
DQPHHQPPNRAGAPGESLECPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEELRKVFITYSMDT    351 - 420
AMEVVKFVNFLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVEGAESQLDEDE    421 - 490
HGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYVA    491 - 560
PPRGPLPTLQVVPL                                                            561 - 574
//

Text Mined References (48)

PMID Year Title
26558270 2015 Genetic Polymorphisms of IL-17F and TRAF3IP2 Could Be Predictive Factors of the Long-Term Effect of Infliximab against Crohn's Disease.
26376209 2015 The miR-30a Negatively Regulates IL-17-Mediated Signal Transduction by Targeting Traf3ip2.
26148936 2015 Aldosterone-induced cardiomyocyte growth, and fibroblast migration and proliferation are mediated by TRAF3IP2.
25775161 2015 A pharmacogenetics study in Mozambican patients treated with nevirapine: full resequencing of TRAF3IP2 gene shows a novel association with SJS/TEN susceptibility.
25416956 2014 A proteome-scale map of the human interactome network.
25202827 2015 Syk mediates IL-17-induced CCL20 expression by targeting Act1-dependent K63-linked ubiquitination of TRAF6.
25024377 2014 The differential regulation of human ACT1 isoforms by Hsp90 in IL-17 signaling.
25014791 2014 Immunochip identifies novel, and replicates known, genetic risk loci for rheumatoid arthritis in black South Africans.
24561578 2014 OxLDL induces endothelial dysfunction and death via TRAF3IP2: inhibition by HDL3 and AMPK activators.
24416204 2014 TRAF5 and TRAF3IP2 gene polymorphisms are associated with Behçet's disease and Vogt-Koyanagi-Harada syndrome: a case-control study.
More...