Property Summary

NCBI Gene PubMed Count 52
PubMed Score 71.56
PubTator Score 116.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis -2.100 6.0e-05
acute quadriplegic myopathy 1.140 2.3e-08
astrocytoma 1.100 2.6e-20
Astrocytoma, Pilocytic 1.700 1.9e-06
glioblastoma 1.200 6.7e-05
lung cancer -2.700 1.4e-04
malignant mesothelioma -4.200 3.1e-07
osteosarcoma -3.161 1.2e-10
ovarian cancer -1.200 4.2e-07
posterior fossa group A ependymoma 1.100 2.7e-05
spina bifida -1.508 3.7e-02
ulcerative colitis -1.100 1.6e-05

Gene RIF (38)

AA Sequence

MPPQLQETRMNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFS      1 - 70
QAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQF     71 - 140
SFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDS    141 - 210
QPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSP    211 - 280
DHQVPYGHDYPRAAYQQVIQPALPGQPLPGASVRGLHPVQKVILNYPSPWDHEERPAQRDCSFPGLPRHQ    281 - 350
DQPHHQPPNRAGAPGESLECPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEELRKVFITYSMDT    351 - 420
AMEVVKFVNFLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVEGAESQLDEDE    421 - 490
HGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYVA    491 - 560
PPRGPLPTLQVVPL                                                            561 - 574
//

Text Mined References (53)

PMID Year Title