Property Summary

NCBI Gene PubMed Count 52
PubMed Score 71.56
PubTator Score 116.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis -2.100 6.0e-05
acute quadriplegic myopathy 1.140 2.3e-08
astrocytoma 1.100 2.6e-20
Astrocytoma, Pilocytic 1.700 1.9e-06
glioblastoma 1.200 6.7e-05
lung cancer -2.700 1.4e-04
malignant mesothelioma -4.200 3.1e-07
osteosarcoma -3.161 1.2e-10
ovarian cancer -1.200 4.2e-07
posterior fossa group A ependymoma 1.100 2.7e-05
spina bifida -1.508 3.7e-02
ulcerative colitis -1.100 1.6e-05

Synonym

Accession O43734 B2RAY9 E1P555 Q5R3A3 Q7Z6Q1 Q7Z6Q2 Q7Z6Q3 Q9H5W2 Q9H6Y3 Q9NS14 Q9UG72
Symbols ACT1
CIKS
C6orf2
C6orf4
C6orf5
C6orf6
CANDF8
PSORS13

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (38)

AA Sequence

MPPQLQETRMNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFS      1 - 70
QAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQF     71 - 140
SFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDS    141 - 210
QPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSP    211 - 280
DHQVPYGHDYPRAAYQQVIQPALPGQPLPGASVRGLHPVQKVILNYPSPWDHEERPAQRDCSFPGLPRHQ    281 - 350
DQPHHQPPNRAGAPGESLECPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEELRKVFITYSMDT    351 - 420
AMEVVKFVNFLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVEGAESQLDEDE    421 - 490
HGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYVA    491 - 560
PPRGPLPTLQVVPL                                                            561 - 574
//

Text Mined References (53)

PMID Year Title