Property Summary

NCBI Gene PubMed Count 29
Grant Count 26
R01 Count 26
Funding $1,871,041.48
PubMed Score 10.74
PubTator Score 17.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.270 0.017
malignant mesothelioma 1.300 0.000
astrocytic glioma 1.100 0.024
psoriasis -1.100 0.004
osteosarcoma 2.136 0.000
glioblastoma 1.200 0.007
group 4 medulloblastoma 1.300 0.005
medulloblastoma, large-cell 1.300 0.000
Breast cancer 2.700 0.028
ovarian cancer -1.100 0.028
pituitary cancer -1.700 0.001
dermatomyositis 1.200 0.002

Gene RIF (19)

PMID Text
23153325 This study validates Tat-SF1 as an HDF in CD4+ T cell-derived SupT1 cells.
23153325 Knockdown of HIV-1 Tat specific factor 1 (HTATSF1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells and in CD4+ SupT1 cells
21282347 these findings suggest that Tat-SF1 functions independently in transcription and splicing of cellular genes.
19966273 HIV-1 Tat-mediated splicing is dependent on splicing associated factors Tat-SF1 and CA150
19479034 Tat-SF1 is not required for regulating HIV-1 transcription, but is required for maintaining the ratios of different classes of HIV-1 transcripts.
18187620 HIV-1 Tat-mediated splicing is dependent on splicing associated factors Tat-SF1 and CA150
18187620 Knockdown of HIV-1 Tat specific factor 1 (HTATSF1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells and in CD4+ SupT1 cells
16512786 Intracellular HIV-1 Tat protein represses constitutive LMP2 transcription increasing proteasome activity by interfering with the binding of IRF-1 to STAT1
15564463 phosphorylated by P-TEFb kinase during HIV-1 transcription in Tat/TAR dependent manner
15050687 These results support the notion that Tat-induced neuropathogenesis is mediated by multiple mechanisms involving both intracellular and extracellular Tat protein.
More...

AA Sequence

MSGTNLDGNDEFDEQLRMQELYGDGKDGDTQTDAGGEPDSLGQQPTDTPYEWDLDKKAWFPKITEDFIAT      1 - 70
YQANYGFSNDGASSSTANVEDVHARTAEEPPQEKAPEPTDARKKGEKRKAESGWFHVEEDRNTNVYVSGL     71 - 140
PPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDNQGNLKGDGLCCYLKRESVELALKLLDEDEIRGYK    141 - 210
LHVEVAKFQLKGEYDASKKKKKCKDYKKKLSMQQKQLDWRPERRAGPSRMRHERVVIIKNMFHPMDFEDD    211 - 280
PLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGT    281 - 350
TDYQVEETSREREERLRGWEAFLNAPEANRGLRRSDSVSASERAGPSRARHFSEHPSTSKMNAQETATGM    351 - 420
AFEEPIDEKKFEKTEDGGEFEEGASENNAKESSPEKEAEEGCPEKESEEGCPKRGFEGSCSQKESEEGNP    421 - 490
VRGSEEDSPKKESKKKTLKNDCEENGLAKESEDDLNKESEEEVGPTKESEEDDSEKESDEDCSEKQSEDG    491 - 560
SEREFEENGLEKDLDEEGSEKELHENVLDKELEENDSENSEFEDDGSEKVLDEEGSEREFDEDSDEKEEE    561 - 630
EDTYEKVFDDESDEKEDEEYADEKGLEAADKKAEEGDADEKLFEESDDKEDEDADGKEVEDADEKLFEDD    631 - 700
DSNEKLFDEEEDSSEKLFDDSDERGTLGGFGSVEEGPLSTGSSFILSSDDDDDDI                   701 - 755
//

Text Mined References (40)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23153325 2012 Impact of sustained RNAi-mediated suppression of cellular cofactor Tat-SF1 on HIV-1 replication in CD4+ T cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21282347 2011 Identification of Tat-SF1 cellular targets by exon array analysis reveals dual roles in transcription and splicing.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...