Property Summary

NCBI Gene PubMed Count 29
PubMed Score 11.66
PubTator Score 17.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.100 2.4e-02
Breast cancer 2.700 2.8e-02
dermatomyositis 1.200 2.1e-03
glioblastoma 1.200 7.3e-03
group 4 medulloblastoma 1.300 5.1e-03
malignant mesothelioma 1.300 1.1e-04
medulloblastoma, large-cell 1.300 2.5e-04
Multiple myeloma 1.270 1.7e-02
osteosarcoma 2.136 1.4e-07
ovarian cancer -1.100 2.8e-02
pituitary cancer -1.700 1.4e-03
psoriasis -1.100 4.1e-03

 GO Function (1)

Gene RIF (19)

AA Sequence

MSGTNLDGNDEFDEQLRMQELYGDGKDGDTQTDAGGEPDSLGQQPTDTPYEWDLDKKAWFPKITEDFIAT      1 - 70
YQANYGFSNDGASSSTANVEDVHARTAEEPPQEKAPEPTDARKKGEKRKAESGWFHVEEDRNTNVYVSGL     71 - 140
PPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDNQGNLKGDGLCCYLKRESVELALKLLDEDEIRGYK    141 - 210
LHVEVAKFQLKGEYDASKKKKKCKDYKKKLSMQQKQLDWRPERRAGPSRMRHERVVIIKNMFHPMDFEDD    211 - 280
PLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGT    281 - 350
TDYQVEETSREREERLRGWEAFLNAPEANRGLRRSDSVSASERAGPSRARHFSEHPSTSKMNAQETATGM    351 - 420
AFEEPIDEKKFEKTEDGGEFEEGASENNAKESSPEKEAEEGCPEKESEEGCPKRGFEGSCSQKESEEGNP    421 - 490
VRGSEEDSPKKESKKKTLKNDCEENGLAKESEDDLNKESEEEVGPTKESEEDDSEKESDEDCSEKQSEDG    491 - 560
SEREFEENGLEKDLDEEGSEKELHENVLDKELEENDSENSEFEDDGSEKVLDEEGSEREFDEDSDEKEEE    561 - 630
EDTYEKVFDDESDEKEDEEYADEKGLEAADKKAEEGDADEKLFEESDDKEDEDADGKEVEDADEKLFEDD    631 - 700
DSNEKLFDEEEDSSEKLFDDSDERGTLGGFGSVEEGPLSTGSSFILSSDDDDDDI                   701 - 755
//

Text Mined References (41)

PMID Year Title