Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 55.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 4.2e-05
lung cancer 1.400 2.0e-02
malignant mesothelioma 1.200 3.8e-04
medulloblastoma -1.300 2.5e-03
osteosarcoma 4.055 5.5e-10
Pick disease 1.200 7.0e-05

Gene RIF (3)

AA Sequence

MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAV      1 - 70
DTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS         71 - 136
//

Text Mined References (8)

PMID Year Title