Property Summary

NCBI Gene PubMed Count 13
Grant Count 42
R01 Count 22
Funding $7,899,447.57
PubMed Score 245.08
PubTator Score 17.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.173 0.019
Multiple myeloma 1.956 0.000
astrocytic glioma -1.400 0.029
glioblastoma 1.300 0.001
lung cancer 1.900 0.000
Breast cancer 2.800 0.026
group 3 medulloblastoma 1.100 0.006
ovarian cancer 1.700 0.000

 GO Function (1)

Gene RIF (9)

PMID Text
26071602 crystal structures of free TRIAP1 and TRIAP1-SLMO1 complex reveal how the PRELI domain is chaperoned during import into the intermembrane mitochondrial space; structural resemblance of PRELI-like domain of SLMO1 with that of mammalian phoshatidylinositol transfer proteins suggest they share similar lipid transfer mechanisms
25998939 Results describe the upregulation of TRIAP1 in drugresistant breast cancer cells. Its experimental modulation changed breast tumor cells sensitivity to doxorubicin, thus confirming its role in drug resistance.
23931759 Loss of TRIAP1 or PRELI impairs the accumulation of Cardiolipin, facilitates the release of cytochrome c, and renders cells vulnerable to apoptosis upon intrinsic and extrinsic stimulation.
23684607 TRIAP1 is Conserved Specific Coregulators of the p21:PUMA Expression Ratio.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19171422 Upregulated in at least 50% of multiple myeloma cases tested.
15735665 HSPC132 is p53CSV, a novel p53-inducible gene involved in the p53-dependent cell-survival pathway
15735003 Under specific conditions of stress, p53 regulates transcription of p53CSV and that p53CSV is one of the important players in the p53-mediated cell survival.
15735003 HSPC132 is p53CSV, a novel p53-inducible gene involved in the p53-dependent cell-survival pathway

AA Sequence

MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKE      1 - 70
KPENSS                                                                     71 - 76
//

Text Mined References (18)

PMID Year Title
26071602 2015 Structural insight into the TRIAP1/PRELI-like domain family of mitochondrial phospholipid transfer complexes.
25998939 2015 Apoptosis inhibitor TRIAP1 is a novel effector of drug resistance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23931759 2013 TRIAP1/PRELI complexes prevent apoptosis by mediating intramitochondrial transport of phosphatidic acid.
23684607 2013 A genetic screen identifies TCF3/E2A and TRIAP1 as pathway-specific regulators of the cellular response to p53 activation.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21901158 2011 Genome-wide detection of allele specific copy number variation associated with insulin resistance in African Americans from the HyperGEN study.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...