Property Summary

NCBI Gene PubMed Count 14
PubMed Score 252.68
PubTator Score 17.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.400 2.9e-02
Breast cancer 2.800 2.6e-02
glioblastoma 1.300 1.5e-03
group 3 medulloblastoma 1.100 5.7e-03
lung cancer 1.900 8.2e-05
Multiple myeloma 1.956 2.5e-04
ovarian cancer 1.700 1.8e-04
Waldenstrons macroglobulinemia 1.173 1.9e-02

 GO Function (1)

Protein-protein Interaction (4)

Gene RIF (10)

AA Sequence

MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKE      1 - 70
KPENSS                                                                     71 - 76
//

Text Mined References (19)

PMID Year Title