Property Summary

NCBI Gene PubMed Count 28
Grant Count 14
R01 Count 10
Funding $1,381,443.07
PubMed Score 51.41
PubTator Score 47.28

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (21)

PMID Text
26852660 Immunophenotyping with CD135 and CD117 predicts the FLT3, IL-7R and TLX3 gene mutations in childhood T-cell acute leukemia.
24997618 Studies suggest that homeobox protein TLX3 expression is not an indicator for the prognosis of pediatric T cell acute lymphocytic leukemia (T-ALL).
24571118 Egyptian T-cell acute lymphoblastic leukemia cases seemed to have a different genetic pattern compared to other populations, with a lower incidence of TLX3/HOX11L2 and SIL/TAL but a higher incidence of NKX2-5 expression than recorded in Western countries
22516263 The cortical thymic maturation arrest in T-lineage Acute lymphoblastic leukemias (ALLs) that overexpress TLX1 or TLX3 is due to binding of TLX1/TLX3 to ETS1.
22366949 these results place TLX1 and TLX3 at the top of an oncogenic transcriptional network controlling leukemia development, and identify RUNX1 as a tumor-suppressor gene in T-ALL
21617853 We found that 22 (21%) out of 110 clinical samples of bladder cancer showed the methylated pattern using the COBRA assay in TLX3. We found a correlation between TLX3 methylation and the sensitivity to cisplatin in the clinical samples by SDI test.
21374761 Results identify Tlx3 as a novel target for canonical Wnt signaling that confers somatic stem cells with a sensory neuron phenotype upon neural induction.
21225930 High TLX3/BCL11B fusion protein expression is associated with T/myeloid acute bilineal leukemia.
18368072 Aberrant HOX11L2 expression is associated with thymic adult T-cell acute lymphoblastic leukemia
18185524 five recurrent genomic deletions in TLX3 rearranged T-ALL; genome-wide overview of copy number changes in TLX3 rearranged T-ALL
More...

AA Sequence

MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGATYPSLPASFAGLGAPF      1 - 70
EDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFT     71 - 140
AAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQV    141 - 210
KTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEED    211 - 280
SSKVPAVTSLV                                                               281 - 291
//

Text Mined References (28)

PMID Year Title
26852660 2016 Immunophenotyping with CD135 and CD117 predicts the FLT3, IL-7R and TLX3 gene mutations in childhood T-cell acute leukemia.
25428367 2014 Prediction of DNA binding motifs from 3D models of transcription factors; identifying TLX3 regulated genes.
24997618 2014 The effect of TLX3 expression on the prognosis of pediatric T cell acute lymphocytic leukemia--a systematic review.
24571118 2016 NKX2-5, SIL/TAL and TLX3/HOX11L2 expression in Egyptian pediatric T-cell acute lymphoblastic leukemia.
22516263 2012 TLX homeodomain oncogenes mediate T cell maturation arrest in T-ALL via interaction with ETS1 and suppression of TCR? gene expression.
22366949 2012 Reverse engineering of TLX oncogenic transcriptional networks identifies RUNX1 as tumor suppressor in T-ALL.
21617853 2011 Aberrant DNA methylation of T-cell leukemia, homeobox 3 modulates cisplatin sensitivity in bladder cancer.
21374761 2011 Wnt signaling promotes neuronal differentiation from mesenchymal stem cells through activation of Tlx3.
21225930 2011 Successful treatment of a child with T/myeloid acute bilineal leukemia associated with TLX3/BCL11B fusion and 9q deletion.
18368072 2008 Thymic adult T-cell acute lymphoblastic leukemia stratified in standard- and high-risk group by aberrant HOX11L2 expression: experience of the German multicenter ALL study group.
More...