Property Summary

NCBI Gene PubMed Count 24
PubMed Score 0.00
PubTator Score 8.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
esophageal adenocarcinoma 1.100 2.1e-02
glioblastoma 1.200 2.3e-03
group 3 medulloblastoma 1.100 2.7e-03
lung adenocarcinoma 1.132 2.8e-06
Multiple myeloma 2.001 3.5e-04
ovarian cancer 1.100 1.2e-04

Gene RIF (7)

AA Sequence

MASRGRRPEHGGPPELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSY      1 - 70
LSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDMGQGIPFKPGTFDGCISISAVQWLCNANKKSENPAK     71 - 140
RLYCFFASLFSVLVRGSRAVLQLYPENSEQLELITTQATKAGFSGGMVVDYPNSAKAKKFYLCLFSGPST    141 - 210
FIPEGLSENQDEVEPRESVFTNERFPLRMSRRGMVRKSRAWVLEKKERHRRQGREVRPDTQYTGRKRKPR    211 - 280
F//

Text Mined References (26)

PMID Year Title