Property Summary

NCBI Gene PubMed Count 57
PubMed Score 99.52
PubTator Score 95.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Urinary Bladder Neoplasms 114 0.0 0.0
Vestibular Diseases 7 0.0 0.0
Disease Target Count
Bipolar Disorder 666
Bladder Neoplasm 112
Disease Target Count P-value
osteosarcoma 7950 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Tyrosinemia 10 5.019 2.5
Lactic acidosis 51 4.296 2.1
Alkaptonuria 4 3.693 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.006 1.3e-02

Gene RIF (44)

AA Sequence

MQAGKPILYSYFRSSCSWRVRIALALKGIDYKTVPINLIKDRGQQFSKDFQALNPMKQVPTLKIDGITIH      1 - 70
QSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFN     71 - 140
ALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDT    141 - 210
PTELRA                                                                    211 - 216
//

Text Mined References (60)

PMID Year Title