Property Summary

NCBI Gene PubMed Count 144
Grant Count 118
R01 Count 71
Funding $10,427,689.53
PubMed Score 162.18
PubTator Score 460.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis -1.300 0.048
psoriasis -1.300 0.004
astrocytoma 1.600 0.003
pancreatic ductal adenocarcinoma liver m... 1.302 0.014
intraductal papillary-mucinous neoplasm ... 1.200 0.002
acute myeloid leukemia 1.100 0.005
ovarian cancer 1.500 0.000

Synonym

Accession O43707 A4K467 D6PXK4 O76048
Symbols FSGS
FSGS1
ACTININ-4

Gene

PDB

1WLX   1YDI   2R0O  

Gene RIF (87)

PMID Text
26995963 Selective regulation of NF-kappaB gene targets may indicate involvement of ACTN4 in determining the specificity of cell response to NF-kappaB activation in cells of different types. (Review)
26432781 This study identified alpha-actinin-4 as a novel NHERF1 interaction partner and provided new insights into the regulatory mechanism of the actin cytoskeleton by NHERF1.
26094769 SLK interacts with Tpr and alpha-actinin-4 in cells, and these protein-protein interactions may control the subcellular localization and the biological activity of SLK.
25944910 alpha-actinin-4 is a novel group 1 mGluR-interacting partner that orchestrates spine dynamics and morphogenesis in neurons.
25918384 Using fluorescence recovery after photobleaching, we show that an ACTN4 mutation that causes human kidney disease roughly triples the wild-type binding affinity of ACTN4 to F-actin in cells, increasing the dissociation time from 29 +/- 13 to 86 +/- 29 s.
25885339 The contribution of ACTN4 to the process of lung cancer metastasis to the brain could be mainly through regulation of actin cytoskeleton reorganization, cell motility, and focal adhesion.
25860875 ZYX defective binding to ACTN4, which occupies focal adhesions instead of ACTN1, induces the formation of immature focal adhesions, resulting in the enhancement of cell motility and invasion.
25750325 ACTN4va expression was also significantly related to distant metastasis
25602965 The copy number of ACTN4 is a predictive biomarker for Chemoradiotherapy of locally advanced pancreatic cancer.
25411248 ACTN4 is a transcriptional coactivator of NF-kappaB.
More...

AA Sequence

MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ      1 - 70
IENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAK     71 - 140
MTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELI    141 - 210
EYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANR    211 - 280
ICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEK    281 - 350
CQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQ    351 - 420
KASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHN    421 - 490
VNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTI    491 - 560
EEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLV    561 - 630
PKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDY    631 - 700
KPNLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEF    701 - 770
RASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETT    771 - 840
DTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKSFSTALYGESD    841 - 910
L//

Text Mined References (150)

PMID Year Title
26995963 2015 [ALPHA-ACTININS AND SIGNAL TRANSDUCTION PATHWAYS].
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26432781 2016 NHERF1 regulates actin cytoskeleton organization through modulation of ?-actinin-4 stability.
26094769 2015 Identification of Tpr and ?-actinin-4 as two novel SLK-interacting proteins.
25944910 2015 Actinin-4 Governs Dendritic Spine Dynamics and Promotes Their Remodeling by Metabotropic Glutamate Receptors.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25918384 2015 Alpha-actinin binding kinetics modulate cellular dynamics and force generation.
25885339 2015 ACTN4 and the pathways associated with cell motility and adhesion contribute to the process of lung cancer metastasis to the brain.
25860875 2015 ?-Actinin-4 enhances colorectal cancer cell invasion by suppressing focal adhesion maturation.
More...