Property Summary

NCBI Gene PubMed Count 8
PubMed Score 13.41
PubTator Score 7.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
osteosarcoma 3.634 0.008
atypical teratoid / rhabdoid tumor 2.700 0.018
Atopic dermatitis 2.000 0.000
non-small cell lung cancer 1.950 0.000
lung cancer 1.500 0.002
colon cancer -1.500 0.017
interstitial cystitis 2.300 0.002
cystic fibrosis 1.100 0.006
psoriasis 2.000 0.000
Endometriosis -1.991 0.037
breast carcinoma -2.500 0.000
Breast cancer -5.800 0.000
ulcerative colitis 4.100 0.001
pituitary cancer -1.200 0.000
head and neck cancer 1.400 0.044
head and neck cancer and chronic obstruc... 1.600 0.014

AA Sequence

MIAISAVSSALLFSLLCEASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAI      1 - 70
LDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVK     71 - 140
PWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCN    141 - 210
YAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLCFPGVTSNYLYWFK                          211 - 258
//

Text Mined References (11)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11287197 2001 Cloning and expression of a novel cysteine-rich secreted protein family member expressed in thyroid and pancreatic mesoderm within the chicken embryo.
10362728 1999 A novel developmentally regulated gene in lung mesenchyme: homology to a tumor-derived trypsin inhibitor.
9473672 1998 cDNA cloning of a novel trypsin inhibitor with similarity to pathogenesis-related proteins, and its frequent expression in human brain cancer cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
More...