Property Summary

NCBI Gene PubMed Count 11
PubMed Score 20.82
PubTator Score 8.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.05244662230601E-25
lung adenocarcinoma 2714 2.14670151892336E-10
malignant mesothelioma 3163 4.67521122135071E-7
interstitial cystitis 2299 1.48706919328245E-4
psoriasis 6685 3.26555922054024E-4
pituitary cancer 1972 3.72411893618786E-4
Down syndrome 548 0.00164195517388072
sonic hedgehog group medulloblastoma 1482 0.00329727117734971
cutaneous lupus erythematosus 1056 0.00533746294105881
subependymal giant cell astrocytoma 2287 0.00627509081160936
invasive ductal carcinoma 2950 0.0114191119527484
ductal carcinoma in situ 1745 0.0118739248243936
medulloblastoma, large-cell 6234 0.0187302365305308
esophageal adenocarcinoma 737 0.0394259257089182

Expression

  Differential Expression (14)

Synonym

Accession O43688 A6NLV0 E9PAY8
Symbols LPP2
PAP-2c
PAP2-g
PPAP2C

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

 MGI Term (1)

Gene RIF (3)

PMID Text
18215144 endogenous LPP2 and LPP3 form homo- and hetero-oligomers, which differ in their subcellular localization and which may confer differing spatial regulation of phosphatidic acid and sphingosine 1-phosphate signalling
16467304 identified a novel and specific role for LPP2 activity and bioactive lipids in regulating cell cycle progression
10992322 Functional study of the mouse homolog

AA Sequence

MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGVTITATVILVS      1 - 70
AGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPNFLAVCDPDWSRVNC     71 - 140
SVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLALYVQARLCWKWARLLRPTVQFFLVAFALYV    141 - 210
GYTRVSDYKHHWSDVLVGLLQGALVAALTVCYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNH    211 - 280
YGYPHSSS                                                                  281 - 288
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18215144 2008 Lipid phosphate phosphatases form homo- and hetero-oligomers: catalytic competency, subcellular distribution and function.
16467304 2006 Lipid phosphate phosphatase-2 activity regulates S-phase entry of the cell cycle in Rat2 fibroblasts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471011 2003 Pulmonary phosphatidic acid phosphatase and lipid phosphate phosphohydrolase.
10992322 2000 Mice mutant for Ppap2c, a homolog of the germ cell migration regulator wunen, are viable and fertile.
9705349 1998 Human type 2 phosphatidic acid phosphohydrolases. Substrate specificity of the type 2a, 2b, and 2c enzymes and cell surface activity of the 2a isoform.
9607309 1998 Identification of a novel human phosphatidic acid phosphatase type 2 isoform.
More...