Property Summary

NCBI Gene PubMed Count 12
PubMed Score 21.03
PubTator Score 8.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 5.3e-03
Down syndrome 1.300 1.6e-03
ductal carcinoma in situ 2.000 1.2e-02
esophageal adenocarcinoma 1.100 3.9e-02
group 4 medulloblastoma -1.300 1.3e-02
interstitial cystitis -1.400 2.0e-03
invasive ductal carcinoma 2.600 1.1e-02
lung adenocarcinoma 1.300 3.0e-12
malignant mesothelioma 1.800 4.7e-07
medulloblastoma, large-cell -1.100 1.9e-02
non-small cell lung cancer 2.670 1.1e-25
pituitary cancer -1.400 3.7e-04
psoriasis 1.200 3.3e-04
subependymal giant cell astrocytoma -1.982 6.3e-03

Synonym

Accession O43688 A6NLV0 E9PAY8
Symbols LPP2
PAP-2c
PAP2-g
PPAP2C

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Gene RIF (3)

AA Sequence

MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGVTITATVILVS      1 - 70
AGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPNFLAVCDPDWSRVNC     71 - 140
SVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLALYVQARLCWKWARLLRPTVQFFLVAFALYV    141 - 210
GYTRVSDYKHHWSDVLVGLLQGALVAALTVCYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNH    211 - 280
YGYPHSSS                                                                  281 - 288
//

Text Mined References (13)

PMID Year Title