Property Summary

NCBI Gene PubMed Count 16
PubMed Score 25.39
PubTator Score 20.61

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

Gene RIF (6)

PMID Text
24302730 PKC tethered to AKAP7alpha was less susceptible to inhibition from the ATP-competitive inhibitor Go6976 and the substrate-competitive inhibitor PKC 20-28, but not the activation-competitive inhibitor calphostin C.
22670899 Data from studies using recombinant proteins suggest that both AKAP7-gamma and AKAP7-alpha exhibit high-affinity interactions with isoenzymes of PKC (protein kinase C); AKAP7 could dictate PKC localization/function.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18082768 AKAP18 contains a phosphodiesterase domain that binds AMP.
17244820 AKAP15 regulates ENaC via a novel PKA-independent pathway
12804576 AKAP7gamma is the first nuclear AKAP to bind RI and may be responsible for positioning PKA via RI and/or RII to regulate PKA-mediated gene transcription in both somatic cells and oocytes

AA Sequence

MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVENAVLKAVQQ      1 - 70
YLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK                                         71 - 104
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24302730 2014 Scaffold state switching amplifies, accelerates, and insulates protein kinase C signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23502783 2013 The CCND1 c.870G>A polymorphism is a risk factor for t(11;14)(q13;q32) multiple myeloma.
22670899 2012 Spatiotemporal regulation of PKC via interactions with AKAP7 isoforms.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18082768 2008 AKAP18 contains a phosphoesterase domain that binds AMP.
17244820 2007 The A-kinase anchoring protein 15 regulates feedback inhibition of the epithelial Na+ channel.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...