Property Summary

NCBI Gene PubMed Count 18
PubMed Score 28.30
PubTator Score 20.61

Knowledge Summary

Patent

No data available

Gene RIF (7)

AA Sequence

MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVENAVLKAVQQ      1 - 70
YLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK                                         71 - 104
//

Text Mined References (20)

PMID Year Title