Property Summary

NCBI Gene PubMed Count 47
Grant Count 66
R01 Count 54
Funding $6,021,055.67
PubMed Score 73.17
PubTator Score 43.64

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O43684 A6NJ42 B2R6E7 D3DRE9 O43685
Symbols BUB3L
hBUB3

Gene

 GO Function (1)

Gene RIF (16)

PMID Text
26526612 a mutual antagonism exists between Bub3 and dynein to ensure optimal KT-MT attachments
26148513 We show that kinetochore recruitment of BUBR1 and BUB3 by BUB1 is dispensable for SAC activation
25814666 the mechanisms of BUB3 in mitotic checkpoint signaling
25661489 Data show sequential multisite regulation of the microtubule-associated protein KNL1-kinase-adaptor complex BUB1/BUB3 interaction.
25246557 Data indicate that cell cycle protein Bub3-mediated kinetochore recruitment of BubR1 kinase enhances mitotic checkpoint signaling.
25003721 Results suggest that these USP7-dependent effects are mediated by decreased levels of spindle assembly checkpoint (SAC) component Bub3.
24711138 Results showed that neither variants in BUB3 nor variants in MAD2L1 caused any significant effect on the risk of breast cancer
24066227 Mutations targeting the Bub3 interface prevent kinetochore recruitment of the SAC kinase Bub1. Crucially, they also cause a checkpoint defect, showing that recognition of phosphorylated targets by Bub3 is required for checkpoint signaling
23747338 Mutations in BUB1 and BUB3 cause mosaic variegated aneuploidy and increase the risk of colorectal cancer at a young age.
20734064 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDPTHA      1 - 70
WSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWDPRTPCNAGTFSQPEKV     71 - 140
YTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLDP    141 - 210
SPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIA    211 - 280
SLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSPCT                          281 - 328
//

Text Mined References (53)

PMID Year Title
26526612 2015 Co-silencing of human Bub3 and dynein highlights an antagonistic relationship in regulating kinetochore-microtubule attachments.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26148513 2015 Dissecting the roles of human BUB1 in the spindle assembly checkpoint.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25814666 2015 A motif from Lys216 to Lys222 in human BUB3 protein is a nuclear localization signal and critical for BUB3 function in mitotic checkpoint.
25661489 2015 Sequential multisite phospho-regulation of KNL1-BUB3 interfaces at mitotic kinetochores.
25416956 2014 A proteome-scale map of the human interactome network.
25246557 2014 Bimodal activation of BubR1 by Bub3 sustains mitotic checkpoint signaling.
25003721 2014 Usp7 protects genomic stability by regulating Bub3.
24711138 2014 Genetic variation in the major mitotic checkpoint genes and risk of breast cancer: a multigenic study on cancer susceptibility.
More...