Property Summary

NCBI Gene PubMed Count 50
PubMed Score 76.11
PubTator Score 43.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 0.0242437391459974
Disease Target Count Z-score Confidence
Cancer 2499 3.343 1.7

Expression

  Differential Expression (21)

 GO Function (1)

Gene RIF (17)

AA Sequence

MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDPTHA      1 - 70
WSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWDPRTPCNAGTFSQPEKV     71 - 140
YTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLDP    141 - 210
SPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIA    211 - 280
SLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSPCT                          281 - 328
//

Text Mined References (56)

PMID Year Title