Property Summary

NCBI Gene PubMed Count 99
Grant Count 145
R01 Count 118
Funding $12,907,061.88
PubMed Score 192.75
PubTator Score 145.65

Knowledge Summary

Patent (20,701)

Expression

Synonym

Accession O43683 E9PC26 F5GXI5 O43430 O43643 O60626 Q53QE4 hBUB1
Symbols BUB1A
BUB1L
hBUB1

Gene

PDB

2LAH   4A1G   4QPM   4R8Q   5DMZ  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (70)

PMID Text
26912231 Bub1-Plk1-mediated phosphorylation of Cdc20 constitutes an anaphase-promoting complex or cyclosome-inhibitory mechanism that is parallel, but not redundant, to mitotic checkpoint complex formation.
26658523 Data show that mitotic checkpoint kinase Bub1 is an active kinase regulated by intra-molecular phosphorylation at the P+1 loop.
26522589 Bub1 may be associated with cancer stem cell potential.
26399325 Data provide novel insight into the regulation and kinetochore residency of Bub1 and indicate that its localization is dynamic and tightly controlled through feedback autophosphorylation.
26287798 MAD2L1 and BUB1 may play important roles in breast cancer progression, and measuring the expression of these genes may assist the prediction of breast cancer prognosis.
26260062 Both Bub1 and BubR1 bind stably to Bub3 that is required for kinetochore localization of the proteins
26223641 Bub1 in complex with LANA recruits PCNA to regulate Kaposi's sarcoma-associated herpesvirus latent replication and DNA translesion synthesis.
26148513 human BUB1 does not associate stably with the MAD2 activator MAD1 (also known as MAD1L1) and, although required for accelerating the loading of MAD1 onto kinetochores, BUB1 is dispensable for the maintenance of steady-state levels of MAD1 there
26031201 Bub1 coordinates checkpoint signalling by distinct domains for RZZ and BubR1 recruitment and localizes antagonistic checkpoint activities.
25731686 BubR1 is a component of the Mitotic checkpoint complex and was reported to be overexpressed in Breast cancer. BubR1 overexpression was correlated with poor survival in early stage Breast cancer patients.
More...

AA Sequence

MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFIS      1 - 70
YCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQY     71 - 140
RLFQTRLTETHLPAQARTSEPLHNVQVLNQMITSKSNPGNNMACISKNQGSELSGVISSACDKESNMERR    141 - 210
VITISKSEYSVHSSLASKVDVEQVVMYCKEKLIRGESEFSFEELRAQKYNQRRKHEQWVNEDRHYMKRKE    211 - 280
ANAFEEQLLKQKMDELHKKLHQVVETSHEDLPASQERSEVNPARMGPSVGSQQELRAPCLPVTYQQTPVN    281 - 350
MEKNPREAPPVVPPLANAISAALVSPATSQSIAPPVPLKAQTVTDSMFAVASKDAGCVNKSTHEFKPQSG    351 - 420
AEIKEGCETHKVANTSSFHTTPNTSLGMVQATPSKVQPSPTVHTKEALGFIMNMFQAPTLPDISDDKDEW    421 - 490
QSLDQNEDAFEAQFQKNVRSSGAWGVNKIISSLSSAFHVFEDGNKENYGLPQPKNKPTGARTFGERSVSR    491 - 560
LPSKPKEEVPHAEEFLDDSTVWGIRCNKTLAPSPKSPGDFTSAAQLASTPFHKLPVESVHILEDKENVVA    561 - 630
KQCTQATLDSCEENMVVPSRDGKFSPIQEKSPKQALSSHMYSASLLRLSQPAAGGVLTCEAELGVEACRL    631 - 700
TDTDAAIAEDPPDAIAGLQAEWMQMSSLGTVDAPNFIVGNPWDDKLIFKLLSGLSKPVSSYPNTFEWQCK    701 - 770
LPAIKPKTEFQLGSKLVYVHHLLGEGAFAQVYEATQGDLNDAKNKQKFVLKVQKPANPWEFYIGTQLMER    771 - 840
LKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMRMLYMIEQVHD    841 - 910
CEIIHGDIKPDNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGTIFTAKCETSGFQCVEMLSNK    911 - 980
PWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFRRLPHLDMWNEFFHVMLNIPDCHHLPSLDLL    981 - 1050
RQKLKKVFQQHYTNKIRALRNRLIVLLLECKRSRK                                      1051 - 1085
//

Text Mined References (111)

PMID Year Title
26912231 2016 The Bub1-Plk1 kinase complex promotes spindle checkpoint signalling through Cdc20 phosphorylation.
26658523 2015 Role of Intrinsic and Extrinsic Factors in the Regulation of the Mitotic Checkpoint Kinase Bub1.
26522589 2015 Bub1 is required for maintaining cancer stem cells in breast cancer cell lines.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26399325 2015 Bub1 autophosphorylation feeds back to regulate kinetochore docking and promote localized substrate phosphorylation.
26287798 2015 Biological and Clinical Significance of MAD2L1 and BUB1, Genes Frequently Appearing in Expression Signatures for Breast Cancer Prognosis.
26260062 2015 Bub1/BubR1: swiss army knives at kinetochores.
26223641 2015 Bub1 in Complex with LANA Recruits PCNA To Regulate Kaposi's Sarcoma-Associated Herpesvirus Latent Replication and DNA Translesion Synthesis.
26148513 2015 Dissecting the roles of human BUB1 in the spindle assembly checkpoint.
26031201 2015 Distinct domains in Bub1 localize RZZ and BubR1 to kinetochores to regulate the checkpoint.
More...