Property Summary

NCBI Gene PubMed Count 25
Grant Count 25
R01 Count 19
Funding $4,441,510.13
PubMed Score 72.31
PubTator Score 43.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.018
pancreatic cancer -1.100 0.022
Multiple myeloma 1.149 0.000
psoriasis 1.400 0.000
lung cancer 1.200 0.008
pancreatic carcinoma -1.100 0.022
ovarian cancer 1.700 0.000

Gene RIF (14)

PMID Text
26675233 Emerin interacts with TRC40 in situ.
24885147 The repertoire of VAPB interactors is more diverse than previously anticipated and link VAPB to the function of ATPase complexes such as p97/FAF1 and ASNA1/transmembrane-domain recognition complex.
23460677 PEX19 formed a complex with the peroxisomal tail anchored protein PEX26 in the cytosol and translocated it directly to peroxisomes by a TRC40-independent class I pathway.
23166591 Expression of HIV-1 Tat upregulates the abundance of arsA arsenite transporter, ATP-binding, homolog 1 (ASNA1) in the nucleoli of Jurkat T-cells
23041287 Results indicate calcium-modulating cyclophilin ligand (CAML) and WRB as components of the TRC40 receptor complex and a crucial mechanism for driving ER membrane insertion of TA proteins in mammalian cells.
22505607 Proteins bind to TRC40 and can utilise this component for their delivery to the ER membrane.
21878631 Post-translational membrane insertion of tail-anchored transmembrane EF-hand Ca2+ sensor calneurons requires the TRC40/Asna1 protein chaperone.
21444755 The coiled-coil domain of WRB is the binding site for TRC40/Asna1.
21296983 Asna1 is required for efficient histocompatibility (HLA) class I downregulation mediated by viral protein BNLF2a.
20375064 Asna1 can mediate membrane insertion of RAMP4 and Sec61beta without the participation of other cytosolic proteins by a mechanism that depends on the presence of ATP or ADP and a protease-sensitive receptor in the endoplasmic reticulum membrane.
More...

AA Sequence

MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLI      1 - 70
ISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAELPDEFFEEDNMLSMGKKMMQEAMSAFP     71 - 140
GIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLLNFPTIVERGLGRLMQIKNQISPFISQMCNMLGL    141 - 210
GDMNADQLASKLEETLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIVNQL    211 - 280
VFPDPEKPCKMCEARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLLEPYKPPSAQ      281 - 348
//

Text Mined References (32)

PMID Year Title
26675233 2016 Emery-Dreifuss muscular dystrophy mutations impair TRC40-mediated targeting of emerin to the inner nuclear membrane.
25416956 2014 A proteome-scale map of the human interactome network.
24885147 2014 VAPB/ALS8 interacts with FFAT-like proteins including the p97 cofactor FAF1 and the ASNA1 ATPase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23460677 2013 Tail-anchored PEX26 targets peroxisomes via a PEX19-dependent and TRC40-independent class I pathway.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23041287 2012 Molecular machinery for insertion of tail-anchored membrane proteins into the endoplasmic reticulum membrane in mammalian cells.
22505607 2012 TRC40 can deliver short secretory proteins to the Sec61 translocon.
21878631 2011 Post-translational membrane insertion of tail-anchored transmembrane EF-hand Ca2+ sensor calneurons requires the TRC40/Asna1 protein chaperone.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...