Property Summary

NCBI Gene PubMed Count 29
PubMed Score 75.92
PubTator Score 43.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
lung cancer 1.200 8.3e-03
Multiple myeloma 1.149 4.2e-04
ovarian cancer 1.700 4.6e-04
pancreatic cancer -1.100 2.2e-02
pancreatic carcinoma -1.100 2.2e-02
psoriasis 1.400 8.5e-05
Rheumatoid arthritis -1.100 1.8e-02

Gene RIF (17)

AA Sequence

MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLI      1 - 70
ISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAELPDEFFEEDNMLSMGKKMMQEAMSAFP     71 - 140
GIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLLNFPTIVERGLGRLMQIKNQISPFISQMCNMLGL    141 - 210
GDMNADQLASKLEETLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIVNQL    211 - 280
VFPDPEKPCKMCEARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLLEPYKPPSAQ      281 - 348
//

Text Mined References (36)

PMID Year Title