Property Summary

NCBI Gene PubMed Count 39
PubMed Score 67.65
PubTator Score 41.49

Knowledge Summary


No data available


  Differential Expression (14)

Disease log2 FC p
adrenocortical adenoma -1.022 4.4e-04
adrenocortical carcinoma -1.779 3.7e-16
aldosterone-producing adenoma -1.424 5.7e-03
cystic fibrosis 1.883 7.6e-06
head and neck cancer -1.600 4.4e-02
intraductal papillary-mucinous adenoma (... -2.700 1.3e-04
intraductal papillary-mucinous carcinoma... -3.200 5.4e-05
intraductal papillary-mucinous neoplasm ... -3.100 1.5e-03
lung adenocarcinoma -2.000 1.7e-14
lung cancer -1.400 3.1e-03
lung carcinoma -3.400 1.4e-21
non-small cell lung cancer -1.999 8.1e-12
ovarian cancer -1.700 2.3e-07
psoriasis -1.500 2.7e-09


Accession O43680 E1P581 O43545 Q6ICV0 Q9BZ14 TCF-21
Symbols POD1


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

Gene RIF (24)

AA Sequence

ENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS                                   141 - 179

Text Mined References (39)

PMID Year Title