Property Summary

NCBI Gene PubMed Count 35
Grant Count 34
R01 Count 22
Funding $4,448,634.94
PubMed Score 57.80
PubTator Score 41.49

Knowledge Summary

Patent

No data available

Expression

 GO Component (1)

Gene RIF (20)

PMID Text
26435499 TCF21 may function as a tumor suppressor gene, which is downregulated through promoter hypermethylation in CRC development.
26421305 These findings show that POD-1/TCF21 regulates SF-1 and LRH-1 by distinct mechanisms, contributing to the understanding of POD-1 involvement and its mechanisms of action in adrenal and liver tumorigenesis.
26158413 The presence of significant hypermethylation of TCF21 supports the hypothesis that hypermethylation of TCF21 and/or decreased TARID expression lies within the pathogenic pathway of most CCSKs.
26146055 TCF21 could inhibit the proliferation and migration of SMMC-7721 hepatocellular carcinoma cells and promote its apoptosis
26044559 our data provided the first evidence that TCF21 mRNA is significantly downregulated in breast cancer cell lines and tissues and regulates breast cancer cell proliferation and EMT.
26020271 Separate enrichment analyses found over-representation of TCF21 target genes among CAD associated genes, and linkage disequilibrium between TCF21 peak variation and that found in GWAS loci consistent with the hypothesis that TCF21 may affect disease risk
25156819 Low TCF21 expression is associated with gastric cancer.
25087872 Results show that TARID, an antisense lncRNA activates TCF21 expression by inducing promoter demethylation.
24758904 TCF21 inhibits the proliferation and migration and facilitates early apoptosis of A549 cells.
24676100 these data suggest that miR-224 interaction with the TCF21 transcript contributes to allelic imbalance of this gene, thus partly explaining the genetic risk for coronary heart disease associated at 6q23.2
More...

AA Sequence

MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRRKAPTKKSPLS      1 - 70
GVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKY     71 - 140
ENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS                                   141 - 179
//

Text Mined References (35)

PMID Year Title
26435499 2016 Down-regulation of TCF21 by hypermethylation induces cell proliferation, migration and invasion in colorectal cancer.
26421305 2015 POD-1/TCF21 Reduces SHP Expression, Affecting LRH-1 Regulation and Cell Cycle Balance in Adrenocortical and Hepatocarcinoma Tumor Cells.
26158413 2015 TCF21 hypermethylation in genetically quiescent clear cell sarcoma of the kidney.
26146055 2015 [Over-expression of transcription factor 21 inhibits the proliferation and migration and promotes apoptosis of SMMC-7721 cells].
26044559 2015 Clinicopathological significance and biological role of TCF21 mRNA in breast cancer.
26020271 2015 Characterization of TCF21 Downstream Target Regions Identifies a Transcriptional Network Linking Multiple Independent Coronary Artery Disease Loci.
25156819 2015 Protein expression and promoter methylation of the candidate biomarker TCF21 in gastric cancer.
25087872 2014 Long noncoding RNA TARID directs demethylation and activation of the tumor suppressor TCF21 via GADD45A.
24758904 2014 [Effects of tumor suppressor gene TCF21 on the proliferation, migration and apoptosis of A549 cells].
24676100 2014 Coronary heart disease-associated variation in TCF21 disrupts a miR-224 binding site and miRNA-mediated regulation.
More...