Property Summary

NCBI Gene PubMed Count 19
PubMed Score 35.21
PubTator Score 6.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 1.46381374914829E-31
non-small cell lung cancer 2798 2.64481777970719E-29
lung adenocarcinoma 2714 2.54542178344693E-16
lung carcinoma 2844 1.42074893824137E-11
psoriasis 6685 1.02885116462612E-7
atypical teratoid / rhabdoid tumor 4369 2.63375055467544E-7
intraductal papillary-mucinous adenoma (IPMA) 2956 1.92471740802244E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.84734308139462E-6
ulcerative colitis 2087 3.78583412434862E-5
medulloblastoma 1524 4.60353846292273E-5
Duchenne muscular dystrophy 602 7.74480795274309E-5
invasive ductal carcinoma 2950 8.63188749163055E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 1.00178319107863E-4
glioblastoma 5572 2.9244959176042E-4
ductal carcinoma in situ 1745 0.0014707538342489
medulloblastoma, large-cell 6234 0.00214697499478809
astrocytic glioma 2241 0.00232995102880043
pediatric high grade glioma 2712 0.00369453044884117
ovarian cancer 8492 0.00490427378304947
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0125019592838861
oligodendroglioma 2849 0.0129509710670351
severe Alzheimer's disease 49 0.0145280439439383
osteosarcoma 7933 0.0187314485710228
facioscapulohumeral dystrophy 286 0.0189447931453791
pilocytic astrocytoma 3086 0.0197938952746047
Pick disease 1893 0.0375784226960545
ependymoma 2514 0.048001358140959
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 0.0 2.0
Disease Target Count Z-score Confidence
nail-patella syndrome 16 4.349 2.2

Expression

Synonym

Accession O43679 O60619 O75480 LDB-2
Symbols LDB1
CLIM1
LDB-2

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans EggNOG Inparanoid

Gene RIF (3)

PMID Text
24925974 LDB2 was the most connected gene in a transcription factor regulatory network inferred from transendothelial migration of leukocyte and atherosclerosis module genes in coronary and carotid artery disease macrophages.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19997623 The transcription co-factor LIM domain binding 2 (LDB2) was identified as a potential high-hierarchy regulator of the atherosclerosis-module.

AA Sequence

MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFC      1 - 70
LEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCTMVTQHGKPMFTKVCTE     71 - 140
GRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVIL    141 - 210
EPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNNANSTG    211 - 280
SKKKTTAANLSLSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDFNNSPALGNNS    281 - 350
PWNSKPPATQETKSENPPPQASQ                                                   351 - 373
//

Text Mined References (21)

PMID Year Title
24925974 2014 Lim domain binding 2: a key driver of transendothelial migration of leukocytes and atherosclerosis.
23585552 2013 Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19997623 2009 Multi-organ expression profiling uncovers a gene module in coronary artery disease involving transendothelial migration of leukocytes and LIM domain binding 2: the Stockholm Atherosclerosis Gene Expression (STAGE) study.
16815859 2006 Spliced isoforms of LIM-domain-binding protein (CLIM/NLI/Ldb) lacking the LIM-interaction domain.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
More...