Property Summary

NCBI Gene PubMed Count 19
Grant Count 2
R01 Count 1
Funding $432,046.2
PubMed Score 35.21
PubTator Score 6.84

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
24925974 LDB2 was the most connected gene in a transcription factor regulatory network inferred from transendothelial migration of leukocyte and atherosclerosis module genes in coronary and carotid artery disease macrophages.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19997623 The transcription co-factor LIM domain binding 2 (LDB2) was identified as a potential high-hierarchy regulator of the atherosclerosis-module.

AA Sequence

MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFC      1 - 70
LEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCTMVTQHGKPMFTKVCTE     71 - 140
GRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVIL    141 - 210
EPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNNANSTG    211 - 280
SKKKTTAANLSLSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDFNNSPALGNNS    281 - 350
PWNSKPPATQETKSENPPPQASQ                                                   351 - 373
//

Text Mined References (21)

PMID Year Title
24925974 2014 Lim domain binding 2: a key driver of transendothelial migration of leukocytes and atherosclerosis.
23585552 2013 Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19997623 2009 Multi-organ expression profiling uncovers a gene module in coronary artery disease involving transendothelial migration of leukocytes and LIM domain binding 2: the Stockholm Atherosclerosis Gene Expression (STAGE) study.
16815859 2006 Spliced isoforms of LIM-domain-binding protein (CLIM/NLI/Ldb) lacking the LIM-interaction domain.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
More...