Property Summary

NCBI Gene PubMed Count 20
PubMed Score 38.56
PubTator Score 6.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
astrocytic glioma -2.600 2.3e-03
Astrocytoma, Pilocytic -1.600 2.1e-02
atypical teratoid / rhabdoid tumor -3.600 2.6e-07
autosomal dominant Emery-Dreifuss muscul... 1.111 1.3e-02
breast carcinoma -1.600 1.5e-31
Duchenne muscular dystrophy 1.261 7.7e-05
ductal carcinoma in situ -1.500 1.5e-03
ependymoma -2.500 4.8e-02
facioscapulohumeral dystrophy 2.200 1.9e-02
glioblastoma -1.600 3.8e-03
group 4 medulloblastoma -3.300 2.8e-03
intraductal papillary-mucinous adenoma (... -2.700 1.9e-06
intraductal papillary-mucinous carcinoma... -2.900 5.8e-06
intraductal papillary-mucinous neoplasm ... -2.900 1.0e-04
invasive ductal carcinoma -1.329 1.0e-03
lung adenocarcinoma -1.800 3.1e-17
lung carcinoma -2.000 1.4e-11
medulloblastoma, large-cell -3.500 2.1e-03
non-small cell lung cancer -2.795 2.6e-29
oligodendroglioma -2.200 1.3e-02
osteosarcoma -1.625 1.9e-02
ovarian cancer -1.400 1.3e-07
pediatric high grade glioma -2.200 3.7e-03
Pick disease -1.400 3.8e-02
psoriasis -1.100 1.6e-02
severe Alzheimer's disease -1.524 1.5e-02
ulcerative colitis 1.900 3.8e-05

Synonym

Accession O43679 O60619 O75480 LDB-2
Symbols LDB1
CLIM1
LDB-2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFC      1 - 70
LEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCTMVTQHGKPMFTKVCTE     71 - 140
GRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVIL    141 - 210
EPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNNANSTG    211 - 280
SKKKTTAANLSLSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDFNNSPALGNNS    281 - 350
PWNSKPPATQETKSENPPPQASQ                                                   351 - 373
//

Text Mined References (22)

PMID Year Title