Property Summary

Ligand Count 1
NCBI Gene PubMed Count 16
PubMed Score 91.91
PubTator Score 52.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Leigh disease 100 0.0 5.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 3.0e-05
psoriasis 6694 9.2e-05
Multiple myeloma 1332 7.8e-04
diabetes mellitus 1728 1.5e-03
ovarian cancer 8520 6.9e-03
oligodendroglioma 2850 1.1e-02
Disease Target Count Z-score Confidence
Mitochondrial complex I deficiency 46 0.0 5.0
Disease Target Count Z-score Confidence
Anemia 365 4.394 2.2
Multiple cranial nerve palsy 3 3.361 1.7
Disease Target Count
Leigh syndrome 28

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.500 1.5e-03
Multiple myeloma 1.822 7.8e-04
oligodendroglioma -1.100 1.1e-02
osteosarcoma -1.336 3.0e-05
ovarian cancer 1.300 6.9e-03
psoriasis -1.700 9.2e-05

Gene RIF (3)

AA Sequence

MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYA      1 - 70
FGQETNVPLNNFSADQVTRALENVLSGKA                                              71 - 99
//

Text Mined References (20)

PMID Year Title