Property Summary

NCBI Gene PubMed Count 15
PubMed Score 87.47
PubTator Score 52.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.822 0.001
oligodendroglioma -1.100 0.011
psoriasis -1.700 0.000
osteosarcoma -1.336 0.000
diabetes mellitus -1.500 0.001
ovarian cancer 1.300 0.007

Synonym

Accession O43678 D6RJD6 Q6IAY8
Symbols B8
CD14
CIB8

Gene

PANTHER Protein Class (1)

PDB

1S3A  

Gene RIF (3)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20713893 A novel mechanism of lipoteichoic acid (LTA)-induced cytokine induction in human peripheral blood cells involves uptake of LTA and subsequent intracellular recognition driven by Toll-like receptor (TLR)2, TLR6, and CD14.
15341729 solution structure shows a thioredoxin fold with highest similarities to the human thioredoxin mutant C73S and thioredoxin 2 from Anabeana sp

AA Sequence

MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYA      1 - 70
FGQETNVPLNNFSADQVTRALENVLSGKA                                              71 - 99
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20713893 2010 Internalization and coreceptor expression are critical for TLR2-mediated recognition of lipoteichoic acid in human peripheral blood.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18826940 2008 Subunits of mitochondrial complex I exist as part of matrix- and membrane-associated subcomplexes in living cells.
18513682 2008 NDUFA2 complex I mutation leads to Leigh disease.
17209039 2007 Identification of mitochondrial complex I assembly intermediates by tracing tagged NDUFS3 demonstrates the entry point of mitochondrial subunits.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...