Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.54
PubTator Score 0.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.124 0.006
Multiple myeloma 1.542 0.000
astrocytic glioma -1.100 0.007
medulloblastoma, large-cell -1.100 0.001
acute quadriplegic myopathy -1.275 0.000
lung cancer 1.600 0.009
active ulcerative colitis -1.034 0.010
gastric carcinoma -1.500 0.014
acute myeloid leukemia -1.100 0.010
ovarian cancer -1.200 0.000

Synonym

Accession O43677 A8K532 Q3MIJ9
Symbols KFYI

Gene

AA Sequence

MAPSALLRPLSRLLAPARLPSGPSVRSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYK      1 - 70
RRNGLE                                                                     71 - 76
//

Text Mined References (13)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
9878551 1998 cDNA of eight nuclear encoded subunits of NADH:ubiquinone oxidoreductase: human complex I cDNA characterization completed.
9763677 1998 Intron based radiation hybrid mapping of 15 complex I genes of the human electron transport chain.
More...