Property Summary

Ligand Count 1
NCBI Gene PubMed Count 14
PubMed Score 0.54
PubTator Score 0.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active ulcerative colitis -1.034 9.5e-03
acute myeloid leukemia -1.100 1.0e-02
acute quadriplegic myopathy -1.275 8.0e-05
astrocytic glioma -1.100 7.0e-03
gastric carcinoma -1.500 1.4e-02
lung cancer 1.600 8.6e-03
medulloblastoma, large-cell -1.100 1.4e-03
Multiple myeloma 1.542 1.1e-04
ovarian cancer -1.200 2.1e-04
Waldenstrons macroglobulinemia 1.124 6.2e-03

AA Sequence

MAPSALLRPLSRLLAPARLPSGPSVRSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYK      1 - 70
RRNGLE                                                                     71 - 76
//

Text Mined References (14)

PMID Year Title