Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.45
PubTator Score 7.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 9.76864671035295E-11
osteosarcoma 7933 2.69893976583149E-8
psoriasis 6685 6.92929023812022E-8
juvenile dermatomyositis 1189 1.64916890883394E-7
Pick disease 1893 6.45757713460684E-7
acute quadriplegic myopathy 1157 1.08002049121309E-6
hepatocellular carcinoma 550 5.40776742666301E-6
Multiple myeloma 1328 1.13507070206501E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.89307670059656E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.47558442473288E-4
gastric cancer 436 6.56827737691271E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 7.41101810969953E-4
ependymoma 2514 0.00124178377676764
oligodendroglioma 2849 0.00143095683323378
pituitary cancer 1972 0.00165816255282655
group 4 medulloblastoma 1875 0.00188149646794394
glioblastoma 5572 0.00276894384945034
lung cancer 4473 0.00286821668886014
astrocytic glioma 2241 0.00319073655863799
medulloblastoma, large-cell 6234 0.0043920541402263
progressive supranuclear palsy 674 0.00556017100723865
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00594246868762597
pancreatic carcinoma 567 0.00648049073344032
pancreatic cancer 2300 0.0064804907334404
primitive neuroectodermal tumor 3031 0.00707718968034744
Waldenstrons macroglobulinemia 765 0.0122303566060719
non primary Sjogren syndrome sicca 840 0.0128464456307274
sarcoidosis 368 0.0168320580183624

Expression

Synonym

Accession O43670 A8K6Y6 E1P660 E1P661 E1P662 Q53XS9 Q96HW5 Q9BUQ7 BuGZ
Symbols BuGZ
hBuGZ

Gene

  Ortholog (11)

Pathway (1)

Gene RIF (1)

PMID Text
26388440 BuGZ forms temperature-dependent liquid droplets alone or on microtubules in physiological buffers. Coacervation in vitro or in spindle and spindle matrix depends on hydrophobic residues in BuGZ. BuGZ coacervation and its binding to microtubules and tubulin are required to promote assembly of spindle and spindle matrix in Xenopus egg extract and in mammalian cells.

AA Sequence

MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIP      1 - 70
GRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSDEYDDDDSAASTSFQPQPVQPQQGYIP     71 - 140
PMAQPGLPPVPGAPGMPPGIPPLMPGVPPLMPGMPPVMPGMPPGMMPMGGMMPPGPGIPPLMPGMPPGMP    141 - 210
PPVPRPGIPPMTQAQAVSAPGILNRPPAPTATVPAPQPPVTKPLFPSAGQMGTPVTSSSTASSNSESLSA    211 - 280
SSKALFPSTAQAQAAVQGPVGTDFKPLNSTPATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSK    281 - 350
PATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRP    351 - 420
PMPPHGQYGGHHQGMPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQGGRY                421 - 478
//

Text Mined References (13)

PMID Year Title
26388440 2015 Phase transition of spindle-associated protein regulate spindle apparatus assembly.
24462187 2014 BuGZ is required for Bub3 stability, Bub1 kinetochore function, and chromosome alignment.
24462186 2014 A microtubule-associated zinc finger protein, BuGZ, regulates mitotic chromosome alignment by ensuring Bub3 stability and kinetochore targeting.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
More...