Property Summary

NCBI Gene PubMed Count 29
Grant Count 19
R01 Count 11
Funding $1,557,160.79
PubMed Score 32.37
PubTator Score 23.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.123 0.022
psoriasis -2.600 0.000
glioblastoma 1.700 0.006
colon cancer -1.500 0.015
lung cancer -1.900 0.001
group 4 medulloblastoma -2.000 0.000
pilocytic astrocytoma 1.200 0.000
subependymal giant cell astrocytoma 2.243 0.013
ulcerative colitis 1.300 0.000
ovarian cancer 2.400 0.000
Breast cancer 1.200 0.001

Gene RIF (14)

PMID Text
26319900 RGS10 could serve in a novel, and previously unknown, role by accelerating the hydrolysis of GTP from Rheb in ovarian cancer cells.
26293348 RGS10 plays a role in chemoresistance in ovarian cancer. Loss of RGS10 enhances survival among these cells.
24475290 Inhibition of HDAC1 and DNMT1 modulate RGS10 expression and decrease ovarian cancer chemoresistance.
23093381 The results suggest unaltered membrane RGS4 and cytosolic RGS10 proteins levels in schizophrenia and major depression.
22210881 Data show that that SPL/RGS/SHP1 complexes are present in resting platelets where constitutive phosphorylation of SPL(Y398) creates an atypical binding site for SHP-1.
21705617 RGS10 is a key molecule that contributes to the inhibition of Galpha-dependent signaling during chemokine-activated alpha4beta1- and alphaLbeta2-dependent T cell adhesion.
21044322 Results establish RGS10 and RGS17 as novel regulators of cell survival and chemoresistance in ovarian cancer cells and suggest that their reduced expression may be diagnostic of chemoresistance.
20816714 RGS10 and RGS4 proteins are both detected in postmortem prefrontal cortex.
20627871 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MQSELCFADIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFK      1 - 70
KMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLK     71 - 140
SDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT                                         141 - 173
//

Text Mined References (34)

PMID Year Title
26319900 2015 Suppression of the GTPase-activating protein RGS10 increases Rheb-GTP and mTOR signaling in ovarian cancer cells.
26293348 2015 Cellular deficiency in the RGS10 protein facilitates chemoresistant ovarian cancer.
24475290 2014 Inhibition of HDAC1 and DNMT1 modulate RGS10 expression and decrease ovarian cancer chemoresistance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23093381 2013 Brain RGS4 and RGS10 protein expression in schizophrenia and depression. Effect of drug treatment.
22210881 2012 A newly identified complex of spinophilin and the tyrosine phosphatase, SHP-1, modulates platelet activation by regulating G protein-dependent signaling.
21705617 2011 RGS10 restricts upregulation by chemokines of T cell adhesion mediated by ?4?1 and ?L?2 integrins.
21269460 2011 Initial characterization of the human central proteome.
21044322 2010 Regulators of G-Protein signaling RGS10 and RGS17 regulate chemoresistance in ovarian cancer cells.
20816714 2010 Characterization of regulators of G-protein signaling RGS4 and RGS10 proteins in the postmortem human brain.
More...