Property Summary

NCBI Gene PubMed Count 29
PubMed Score 31.97
PubTator Score 23.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count
Schizophrenia 1160
Disease Target Count Z-score Confidence
Fibrochondrogenesis 7 3.991 2.0

Expression

  Differential Expression (11)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 2.1e-06
Breast cancer 1.200 9.8e-04
Chronic Lymphocytic Leukemia 1.123 2.2e-02
colon cancer -1.500 1.5e-02
glioblastoma 1.700 5.8e-03
group 4 medulloblastoma -2.000 4.8e-07
lung cancer -1.900 5.5e-04
ovarian cancer 2.400 1.8e-05
psoriasis -2.600 4.9e-05
subependymal giant cell astrocytoma 2.243 1.3e-02
ulcerative colitis 1.300 9.2e-05

Gene RIF (14)

AA Sequence

MQSELCFADIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFK      1 - 70
KMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLK     71 - 140
SDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT                                         141 - 173
//

Text Mined References (34)

PMID Year Title