Property Summary

NCBI Gene PubMed Count 45
PubMed Score 4.86
PubTator Score 119.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (28)

PMID Text
26898432 These findings suggest that the aberrant expression of PRC1 may predict biochemical recurrence in men with prostate cancer highlighting its potential as a prognostic marker of this malignancy.
24725408 Study finds that frictional forces increase nonlinearly with microtubule-associated proteins (MAP) velocity across microtubules and depend on filament polarity, with NuMA's friction being lower when moving toward minus ends, EB1's lower toward plus ends, and PRC1's exhibiting no directional preference.
24460908 The presence of CBX4 or CBX8-GFP in the same focus had a minor impact on BMI1 and RING1 recovery kinetics.
24120663 PP2A-B55 dephosphorylates PRC1 at the metaphase to anaphase transition. This activity is regulated by the Greatwall (MASTL) kinase and its substrate ENSA, explaining the timing of PRC1 activation in anaphase.
23870126 Studies reveal how interactions between the conserved nonmotor MAP, PRC1, and the motor protein, kinesin-4, generate filament length-dependent tags at microtubule plus ends. PRC1 tags ends of microtubules in dividing cells and the size of these tags increases linearly with filament length.
23349393 Different PRC1 paralog family members have nonredundant and locus-specific gene regulatory activities that are essential for human hematopoiesis.
22621898 findings suggest that PRC1 is regulated by Plk1, rather than Cdk1 as previously proposed, because its activity must be spatiotemporally regulated both preanaphase and postanaphase, and Cdk1 activity is too binary for this purpose
22419124 Two distinct mechanisms are involved in CBX2-mediated gene silencing. The short CBX2-2 isoform would repress the transcription in a PRC1-independent fashion, whereas gene repression by the long CBX2-1 isoform is mediated by the PRC1 protein complex.
22323288 Cells depleted of PRC1 failed to form a polarized microtubule array or ectopic furrows following mitotic exit, and recruitment of Aurora B kinase, male germ cell Rac GTPase-activating protein, and RhoA to the cortex was impaired.
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSIS      1 - 70
VCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHY     71 - 140
DIDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEALDHTPDTSFERDVVCEDEDAFCL    141 - 210
SLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVD    211 - 280
RLEELKMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKE    281 - 350
LFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKA    351 - 420
FMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPNTPGKARKLNT    421 - 490
TTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTGRHGANKENLELNGSILSGGY    491 - 560
PGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQRELSKASKSDATSGILNSTNIQS              561 - 620
//

Text Mined References (57)

PMID Year Title
26898432 2016 Protein regulator of cytokinesis 1 overexpression predicts biochemical recurrence in men with prostate cancer.
25038754 2014 Genome-wide association analysis in East Asians identifies breast cancer susceptibility loci at 1q32.1, 5q14.3 and 15q26.1.
24725408 2014 Asymmetric friction of nonmotor MAPs can lead to their directional motion in active microtubule networks.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24460908 2014 PRC1 components exhibit different binding kinetics in Polycomb bodies.
24120663 2013 The BEG (PP2A-B55/ENSA/Greatwall) pathway ensures cytokinesis follows chromosome separation.
23870126 2013 Marking and measuring single microtubules by PRC1 and kinesin-4.
23349393 2013 Nonredundant and locus-specific gene repression functions of PRC1 paralog family members in human hematopoietic stem/progenitor cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...