Property Summary

NCBI Gene PubMed Count 49
PubMed Score 6.30
PubTator Score 119.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Glomerulonephritis, IGA 34 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0

Expression

  Differential Expression (30)

Disease log2 FC p
adrenocortical carcinoma 3.873 2.6e-08
adult high grade glioma 1.500 9.8e-03
Atopic dermatitis 1.300 1.7e-04
atypical teratoid / rhabdoid tumor 1.900 2.7e-06
Breast cancer 2.400 1.8e-16
breast carcinoma 1.600 4.9e-06
Chronic Lymphocytic Leukemia 1.007 3.0e-03
colon cancer 1.300 4.5e-03
ductal carcinoma in situ 2.600 6.2e-04
Endometriosis 2.037 5.7e-03
glioblastoma 2.200 3.8e-08
group 3 medulloblastoma 3.100 2.7e-06
interstitial cystitis 1.200 1.6e-03
intraductal papillary-mucinous carcinoma... 2.800 2.2e-04
intraductal papillary-mucinous neoplasm ... 3.000 8.3e-04
invasive ductal carcinoma 3.300 5.9e-05
lung adenocarcinoma 1.100 1.0e-08
lung cancer 2.800 2.2e-05
medulloblastoma, large-cell 2.500 4.4e-06
nasopharyngeal carcinoma 1.600 1.1e-05
non-small cell lung cancer 3.437 2.3e-33
ovarian cancer 2.100 1.0e-04
pancreatic cancer 1.400 2.9e-06
pituitary cancer 1.500 2.9e-04
posterior fossa group A ependymoma 1.500 1.6e-04
primary Sjogren syndrome 1.200 5.2e-04
primitive neuroectodermal tumor 2.200 6.6e-04
psoriasis 2.000 1.9e-03
subependymal giant cell astrocytoma -1.108 2.0e-02
ulcerative colitis 1.100 9.8e-04

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (31)

AA Sequence

MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSIS      1 - 70
VCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHY     71 - 140
DIDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEALDHTPDTSFERDVVCEDEDAFCL    141 - 210
SLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVD    211 - 280
RLEELKMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKE    281 - 350
LFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKA    351 - 420
FMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPNTPGKARKLNT    421 - 490
TTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTGRHGANKENLELNGSILSGGY    491 - 560
PGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQRELSKASKSDATSGILNSTNIQS              561 - 620
//

Text Mined References (61)

PMID Year Title