Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.69
PubTator Score 6.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.002 0.000
acute quadriplegic myopathy 1.046 0.000
ovarian cancer 2.000 0.000

Synonym

Accession O43660 B3KMK4 Q3KQY5 Q8WUD8
Symbols Cwc1
PRL1
PRP46
PRPF46
TANGO4

Gene

PDB

4YVD  

Gene RIF (4)

PMID Text
22174317 HIV-1 Rev interacting protein, pleiotropic regulator 1 (PLRG1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with PLRG1 is increased by RRE
20467437 A central region in hnRNP-M is required for interaction with CDC5L/PLRG1.
14576297 the interaction between CDC5L and PLRG1 is essential for pre-mRNA splicing
9765207 Study includes the isolation of a cDNA encoding the human PRL1 homolog.

AA Sequence

MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGP      1 - 70
QNATDSYVHKQYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANR     71 - 140
TAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCI    141 - 210
AVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKV    211 - 280
IRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSH    281 - 350
DTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLT    351 - 420
VNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTAEADKTIKVYR    421 - 490
EDDTATEETHPVSWKPEIIKRKRF                                                  491 - 514
//

Text Mined References (20)

PMID Year Title
24332808 2014 PRP19 transforms into a sensor of RPA-ssDNA after DNA damage and drives ATR activation via a ubiquitin-mediated circuitry.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21757653 2011 Assessment of genetic determinants of the association of ?' fibrinogen in relation to cardiovascular disease.
20467437 2010 Direct interaction between hnRNP-M and CDC5L/PLRG1 proteins affects alternative splice site choice.
20176811 2010 Molecular architecture of the human Prp19/CDC5L complex.
19838058 2009 The Pso4 complex splices into the DNA damage response.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...