Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.77
PubTator Score 6.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
juvenile dermatomyositis 1187 3.6e-12
acute quadriplegic myopathy 1158 2.8e-06
ovarian cancer 8519 4.0e-05
Disease Target Count Z-score Confidence
Atherosclerosis 291 0.0 3.0

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy 1.046 2.8e-06
juvenile dermatomyositis 1.002 3.6e-12
ovarian cancer -1.600 4.0e-05

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (4)

AA Sequence

MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGP      1 - 70
QNATDSYVHKQYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANR     71 - 140
TAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCI    141 - 210
AVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKV    211 - 280
IRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSH    281 - 350
DTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLT    351 - 420
VNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTAEADKTIKVYR    421 - 490
EDDTATEETHPVSWKPEIIKRKRF                                                  491 - 514
//

Text Mined References (20)

PMID Year Title