Property Summary

NCBI Gene PubMed Count 20
Grant Count 3
Funding $54,518
PubMed Score 6.30
PubTator Score 4.57

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O43657 Q54A42 Q6IAN9 Tspan-6
Symbols T245
TM4SF6
TSPAN-6

Gene

Gene RIF (1)

PMID Text
22908223 TSPAN6 functions as a negative regulator of the RLR pathway by interacting with MAVS in a ubiquitination-dependent manner.

AA Sequence

MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNVPFVLIATGTV      1 - 70
IILLGTFGCFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYR     71 - 140
SHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEGCFIKVMTIIESEMG    141 - 210
VVAGISFGVACFQLIGIFLAYCLSRAITNNQYEIV                                       211 - 245
//

Text Mined References (21)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22908223 2012 Tetraspanin 6 (TSPAN6) negatively regulates retinoic acid-inducible gene I-like receptor-mediated immune signaling in a ubiquitination-dependent manner.
22091964 2012 Identification of genomic deletions spanning the PCDH19 gene in two unrelated girls with intellectual disability and seizures.
21269460 2011 Initial characterization of the human central proteome.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16314869 2005 Tetraspanin functions and associated microdomains.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15772651 2005 The DNA sequence of the human X chromosome.
More...