Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.53
PubTator Score 4.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
cystic fibrosis 1696 8.3e-05
Breast cancer 3578 3.4e-02
sonic hedgehog group medulloblastoma 467 3.8e-02

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 1.300 3.4e-02
cystic fibrosis -1.676 8.3e-05
sonic hedgehog group medulloblastoma 1.200 3.8e-02

AA Sequence

MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNL      1 - 70
SLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQD     71 - 140
PGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVAT    141 - 210
SSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPT    211 - 280
PPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE                        281 - 330
//

Text Mined References (6)

PMID Year Title