Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.87
PubTator Score 4.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis -1.676 0.000
sonic hedgehog group medulloblastoma 1.200 0.038
Breast cancer 1.300 0.034

AA Sequence

MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNL      1 - 70
SLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQD     71 - 140
PGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVAT    141 - 210
SSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPT    211 - 280
PPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE                        281 - 330
//

Text Mined References (6)

PMID Year Title
17062144 2006 Comparative genomics of vertebrate Fox cluster loci.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
9325056 1997 Chromosome localization, sequence analysis, and expression pattern identify FKHL 18 as a novel human forkhead gene.