Property Summary

NCBI Gene PubMed Count 38
PubMed Score 267.96
PubTator Score 122.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 3.37512461576076E-6
ovarian cancer 8492 3.37648721939619E-6
Multiple myeloma 1328 1.0278708748782E-4
non primary Sjogren syndrome sicca 840 0.026444736879039
Waldenstrons macroglobulinemia 765 0.0388180760427006
Disease Target Count Z-score Confidence
Cancer 2346 3.356 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.100 0.039
Multiple myeloma 1.293 0.000
malignant mesothelioma -1.100 0.000
non primary Sjogren syndrome sicca 1.700 0.026
ovarian cancer 2.500 0.000

Synonym

Accession O43633 B2R4W6 Q3ZTT0
Symbols BC2
BC-2
VPS2
CHMP2
VPS2A

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (8)

PMID Text
25710462 Three-dimensional superresolution microscopy and correlative electron microscopy demonstrate that the ESCRT proteins TSG101, CHMP2A, and CHMP4B co-cluster with membrane-localized HIV-1 Gag at assembly sites
24436186 Three-dimensional superresolution microscopy and correlative electron microscopy demonstrate that the ESCRT proteins TSG101, CHMP2A, and CHMP4B co-cluster with membrane-localized HIV-1 Gag at assembly sites
24107264 Three-dimensional superresolution microscopy and correlative electron microscopy demonstrate that the ESCRT proteins TSG101, CHMP2A, and CHMP4B co-cluster with membrane-localized HIV-1 Gag at assembly sites
23051622 Three-dimensional superresolution microscopy and correlative electron microscopy demonstrate that the ESCRT proteins TSG101, CHMP2A, and CHMP4B co-cluster with membrane-localized HIV-1 Gag at assembly sites
23027949 Three-dimensional superresolution microscopy and correlative electron microscopy demonstrate that the ESCRT proteins TSG101, CHMP2A, and CHMP4B co-cluster with membrane-localized HIV-1 Gag at assembly sites
20708039 Data show that gamma2-adaptin in MVB sorting specifically interacts with the ESCRT subunits Vps28 and CHMP2A.
19460752 Knockdown of charged multivesicular body protein 2A (CHMP2A) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18687924 study found the ESCRT-III proteins CHMP2A & CHMP3 could assemble in vitro into helical tubular structures that expose their membrane interaction sites on the outside of the tubule; VPS4 could bind on the inside of the tubule & disassemble the tubes

AA Sequence

MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTR      1 - 70
RYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKE     71 - 140
EMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADA    141 - 210
DLEERLKNLRRD                                                              211 - 222
//

Text Mined References (45)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26040712 2015 Spastin and ESCRT-III coordinate mitotic spindle disassembly and nuclear envelope sealing.
25416956 2014 A proteome-scale map of the human interactome network.
24878737 2014 Structure of cellular ESCRT-III spirals and their relationship to HIV budding.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24107264 2013 ESCRT requirements for EIAV budding.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23105106 2012 Interactions of the human LIP5 regulatory protein with endosomal sorting complexes required for transport.
More...