Property Summary

NCBI Gene PubMed Count 39
PubMed Score 278.63
PubTator Score 122.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Cancer 2499 3.355 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -1.100 3.4e-06
Multiple myeloma 1.293 1.0e-04
non primary Sjogren syndrome sicca 1.700 2.6e-02
ovarian cancer -1.600 5.7e-07
Waldenstrons macroglobulinemia 1.100 3.9e-02

Protein-protein Interaction (6)

Gene RIF (8)

AA Sequence

MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTR      1 - 70
RYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKE     71 - 140
EMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADA    141 - 210
DLEERLKNLRRD                                                              211 - 222
//

Text Mined References (46)

PMID Year Title