Property Summary

NCBI Gene PubMed Count 210
PubMed Score 1564.66
PubTator Score 463.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
juvenile dermatomyositis 1189 2.14401647410638E-10
malignant mesothelioma 3163 3.65223575453929E-9
posterior fossa group A ependymoma 1511 3.74929634216098E-8
ovarian cancer 8492 1.42642728530168E-7
Duchenne muscular dystrophy 602 1.47052209995121E-7
non-small cell lung cancer 2798 4.74876701984888E-6
acute quadriplegic myopathy 1157 2.01844297477394E-5
nephrosclerosis 329 2.42275559001794E-5
sonic hedgehog group medulloblastoma 1482 2.23260798502857E-4
pediatric high grade glioma 2712 0.00144342145181917
pilocytic astrocytoma 3086 0.0015965930041189
glioblastoma 5572 0.00182500598091229
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00207348951626632
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00267206748019044
atypical teratoid / rhabdoid tumor 4369 0.00446071575531776
mucosa-associated lymphoid tissue lymphoma 480 0.00607487838360918
ulcerative colitis 2087 0.010018622822283
interstitial cystitis 2299 0.0129677204477633
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0185150780557755
osteosarcoma 7933 0.0210233548547194
invasive ductal carcinoma 2950 0.0236089292913118
Breast cancer 3099 0.0248609387717636
Disease Target Count Z-score Confidence
Heart disease 279 0.0 2.0
Disease Target Count Z-score Confidence
Piebaldism 11 4.055 2.0
Disease Target Count Z-score Confidence
Waardenburg's syndrome 16 4.4 2.2
Disease Target Count
Waardenburg syndrome 2D 1

Expression

Synonym

Accession O43623 B2R6P6 Q53FC1
Symbols SLUG
WS2D
SLUGH1
SNAIL2

Gene

  Ortholog (10)

Gene RIF (199)

PMID Text
27012210 4-hydroxytamoxifen resistance in breast cancer cells is suppressed by curcumin, which targets the SLUG/Hexokinase 2 pathway
26992741 we demonstrated that rLZ-8 promoted the interaction between MDM2 and Slug, resulting in Slug degradation
26841870 Sox4 was also able to promote b-catenin-mediated transcription of the Slug gene through formation of transcriptional complexes with b-catenin and p300, independent of TCF4 status
26810856 As a consequence, Slug transcription is down-regulated relieving A549 cells from Slug-mediated repression of E-cadherin transcription, thereby diminishing the metastatic potential of these oncogenic Ras-expressing NSCLC cells
26571812 SNAI1 and SNAI2 - transcriptional master-regulators of epithelial-mesenchimal transition
26561320 Studied the role and putative interactors of SNAI2, a slug protein which is involved in the development of cancer progression. Based upon the computational analysis, we consider HNF4A could be a putative candidate to study zinc finger protein slug.
26561205 Data show that patients with high MDA-9/Syntenin and high Slug expressions were associated with poor overall survival compared to those with low expression in lung adenocarcinomas.
26467042 Our study shows an inversed preferential nuclear expression of SLUG, SOX10, and SOX9 in triple negative and non-triple negative cases.
26459371 highly expressed in stromal villi cells of molar disease
26370982 SOX2 Promotes the Epithelial to Mesenchymal Transition of Esophageal Squamous Cells by Modulating Slug Expression through the Activation of STAT3/HIF-alpha Signaling
More...

AA Sequence

MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLP      1 - 70
NGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTF     71 - 140
SGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGE    141 - 210
KPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH                211 - 268
//

Text Mined References (213)

PMID Year Title
27012210 2016 Curcumin suppresses 4-hydroxytamoxifen resistance in breast cancer cells by targeting SLUG/Hexokinase 2 pathway.
26992741 2016 Ling Zhi-8 reduces lung cancer mobility and metastasis through disruption of focal adhesion and induction of MDM2-mediated Slug degradation.
26841870 2016 Cooperation of Sox4 with ?-catenin/p300 complex in transcriptional regulation of the Slug gene during divergent sarcomatous differentiation in uterine carcinosarcoma.
26810856 2016 Aspirin inhibits epithelial-to-mesenchymal transition and migration of oncogenic K-ras-expressing non-small cell lung carcinoma cells by down-regulating E-cadherin repressor Slug.
26571812 [SNAI1 and SNAI2 - transcriptional master-regulators of epithelial-mesenchimal transition].
26561320 2015 Is HNF4A a candidate to study zinc finger protein slug?
26561205 2016 MDA-9/Syntenin-Slug transcriptional complex promote epithelial-mesenchymal transition and invasion/metastasis in lung adenocarcinoma.
26467042 2015 Differential expression of epithelial–mesenchymal transition and stem cell markers in intrinsic subtypes of breast cancer.
26459371 2015 Specific expression patterns of epithelial to mesenchymal transition factors in gestational molar disease.
26370982 2015 SOX2 Promotes the Epithelial to Mesenchymal Transition of Esophageal Squamous Cells by Modulating Slug Expression through the Activation of STAT3/HIF-? Signaling.
More...