Property Summary

NCBI Gene PubMed Count 210
Grant Count 232
R01 Count 119
Funding $29,413,237.4
PubMed Score 1564.66
PubTator Score 463.03

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O43623 B2R6P6 Q53FC1
Symbols SLUG
WS2D
SLUGH1
SNAIL2

Gene

Gene RIF (200)

PMID Text
27012210 4-hydroxytamoxifen resistance in breast cancer cells is suppressed by curcumin, which targets the SLUG/Hexokinase 2 pathway
26992741 we demonstrated that rLZ-8 promoted the interaction between MDM2 and Slug, resulting in Slug degradation
26841870 Sox4 was also able to promote b-catenin-mediated transcription of the Slug gene through formation of transcriptional complexes with b-catenin and p300, independent of TCF4 status
26810856 As a consequence, Slug transcription is down-regulated relieving A549 cells from Slug-mediated repression of E-cadherin transcription, thereby diminishing the metastatic potential of these oncogenic Ras-expressing NSCLC cells
26571812 SNAI1 and SNAI2 - transcriptional master-regulators of epithelial-mesenchimal transition
26561320 Studied the role and putative interactors of SNAI2, a slug protein which is involved in the development of cancer progression. Based upon the computational analysis, we consider HNF4A could be a putative candidate to study zinc finger protein slug.
26561205 Data show that patients with high MDA-9/Syntenin and high Slug expressions were associated with poor overall survival compared to those with low expression in lung adenocarcinomas.
26467042 Our study shows an inversed preferential nuclear expression of SLUG, SOX10, and SOX9 in triple negative and non-triple negative cases.
26459371 highly expressed in stromal villi cells of molar disease
26370982 SOX2 Promotes the Epithelial to Mesenchymal Transition of Esophageal Squamous Cells by Modulating Slug Expression through the Activation of STAT3/HIF-alpha Signaling
More...

AA Sequence

MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLP      1 - 70
NGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTF     71 - 140
SGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGE    141 - 210
KPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH                211 - 268
//

Text Mined References (213)

PMID Year Title
27012210 2016 Curcumin suppresses 4-hydroxytamoxifen resistance in breast cancer cells by targeting SLUG/Hexokinase 2 pathway.
26992741 2016 Ling Zhi-8 reduces lung cancer mobility and metastasis through disruption of focal adhesion and induction of MDM2-mediated Slug degradation.
26841870 2016 Cooperation of Sox4 with ?-catenin/p300 complex in transcriptional regulation of the Slug gene during divergent sarcomatous differentiation in uterine carcinosarcoma.
26810856 2016 Aspirin inhibits epithelial-to-mesenchymal transition and migration of oncogenic K-ras-expressing non-small cell lung carcinoma cells by down-regulating E-cadherin repressor Slug.
26571812 [SNAI1 and SNAI2 - transcriptional master-regulators of epithelial-mesenchimal transition].
26561320 2015 Is HNF4A a candidate to study zinc finger protein slug?
26561205 2016 MDA-9/Syntenin-Slug transcriptional complex promote epithelial-mesenchymal transition and invasion/metastasis in lung adenocarcinoma.
26467042 2015 Differential expression of epithelial–mesenchymal transition and stem cell markers in intrinsic subtypes of breast cancer.
26459371 2015 Specific expression patterns of epithelial to mesenchymal transition factors in gestational molar disease.
26370982 2015 SOX2 Promotes the Epithelial to Mesenchymal Transition of Esophageal Squamous Cells by Modulating Slug Expression through the Activation of STAT3/HIF-? Signaling.
More...