Property Summary

NCBI Gene PubMed Count 25
PubMed Score 108.88
PubTator Score 100.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 4.2e-04
Multiple myeloma 1332 2.6e-03
Disease Target Count Z-score Confidence
Tietze's syndrome 2 4.647 2.3
Septic arthritis 8 3.393 1.7
Disease Target Count
Bardet-Biedl syndrome 1 22

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.136 2.6e-03
ovarian cancer 1.600 4.2e-04

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHD      1 - 70
FRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALE     71 - 140
MVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE                                  141 - 180
//

Text Mined References (30)

PMID Year Title