Property Summary

NCBI Gene PubMed Count 21
Grant Count 11
R01 Count 10
Funding $1,342,362.2
PubMed Score 107.47
PubTator Score 100.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.136 0.003
ovarian cancer 1.600 0.000

Gene RIF (5)

PMID Text
16908848 Bet3 has strong self-palmitoylating activity
16880271 mBet3p is required for the tethering and fusion of COPII vesicles to each other.
16828797 The crystal structure of human Bet3-Tpc6B heterodimer presented here represents a core sub-complex in the assembly of TRAPP.
15728249 Bet3 functions as a cytosolic factor participating in transport from the ER to the Golgi apparatus
15692564 crystal structure

AA Sequence

MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHD      1 - 70
FRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALE     71 - 140
MVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE                                  141 - 180
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21827752 2011 A yeast two hybrid screen identifies SPATA4 as a TRAPP interactor.
21525244 2011 C4orf41 and TTC-15 are mammalian TRAPP components with a role at an early stage in ER-to-Golgi trafficking.
21482742 2011 Entry and exit mechanisms at the cis-face of the Golgi complex.
21453443 2011 Organization and assembly of the TRAPPII complex.
21269460 2011 Initial characterization of the human central proteome.
19416478 2009 TRAPPC2L is a novel, highly conserved TRAPP-interacting protein.
18930054 2008 Distinct isocomplexes of the TRAPP trafficking factor coexist inside human cells.
More...