Property Summary

NCBI Gene PubMed Count 21
PubMed Score 107.47
PubTator Score 100.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 4.20952303069461E-4
Multiple myeloma 1328 0.00258470511213596
Disease Target Count Z-score Confidence
Tietze's syndrome 2 4.626 2.3
Septic arthritis 8 3.398 1.7
Disease Target Count
Bardet-Biedl syndrome 1 22

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.136 0.003
ovarian cancer 1.600 0.000

Synonym

Accession O43617 A6NDN0 B2RDN2 D3DPS2
Symbols BET3

Gene

PDB

1SZ7   2C0J   2CFH   3KXC  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG

 GWAS Trait (1)

Gene RIF (5)

PMID Text
16908848 Bet3 has strong self-palmitoylating activity
16880271 mBet3p is required for the tethering and fusion of COPII vesicles to each other.
16828797 The crystal structure of human Bet3-Tpc6B heterodimer presented here represents a core sub-complex in the assembly of TRAPP.
15728249 Bet3 functions as a cytosolic factor participating in transport from the ER to the Golgi apparatus
15692564 crystal structure

AA Sequence

MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHD      1 - 70
FRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALE     71 - 140
MVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE                                  141 - 180
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21827752 2011 A yeast two hybrid screen identifies SPATA4 as a TRAPP interactor.
21525244 2011 C4orf41 and TTC-15 are mammalian TRAPP components with a role at an early stage in ER-to-Golgi trafficking.
21482742 2011 Entry and exit mechanisms at the cis-face of the Golgi complex.
21453443 2011 Organization and assembly of the TRAPPII complex.
21269460 2011 Initial characterization of the human central proteome.
19416478 2009 TRAPPC2L is a novel, highly conserved TRAPP-interacting protein.
18930054 2008 Distinct isocomplexes of the TRAPP trafficking factor coexist inside human cells.
More...