Property Summary

NCBI Gene PubMed Count 17
PubMed Score 43.97
PubTator Score 12.38

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 2.01192764986302E-5
psoriasis 6685 1.3196289061639E-4


  Differential Expression (2)

Disease log2 FC p
psoriasis 1.600 0.000
osteosarcoma 1.475 0.000


Accession O43615 A8K0R9 D6W664 Q8N193
Symbols TIM44




  Ortholog (16)

Gene RIF (3)

25749183 The Timm44 gene may be a new target for the treatment of type 2 diabetes
20877624 Observational study of gene-disease association. (HuGE Navigator)
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.

AA Sequence

YVWALCRDQDELNPYAAWRLLDISASSTEQIL                                          421 - 452

Text Mined References (22)

PMID Year Title
26090338 2015 Mitochondrial Ion Channels in Cancer Transformation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25749183 2015 Translocase of inner mitochondrial membrane 44 alters the mitochondrial fusion and fission dynamics and protects from type 2 diabetes.
25666615 2015 The E3 ubiquitin ligase parkin is recruited to the 26 S proteasome via the proteasomal ubiquitin receptor Rpn13.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.