Tdark | Mitochondrial import inner membrane translocase subunit TIM44 |
Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Recruits mitochondrial HSP70 to drive protein translocation into the matrix using ATP as an energy source.
This gene encodes a peripheral membrane protein associated with the mitochondrial inner membrane translocase, which functions in the import of proteins across the mitochondrial inner membrane and into the mitochondrial matrix. The encoded protein mediates binding of mitochondrial heat shock protein 70 to the translocase of inner mitochondrial membrane 23 (TIM23) complex. Expression of this gene is upregulated in kidney in a mouse model of diabetes. A mutation in this gene is associated with familial oncocytic thyroid carcinoma. [provided by RefSeq, Jul 2016]
This gene encodes a peripheral membrane protein associated with the mitochondrial inner membrane translocase, which functions in the import of proteins across the mitochondrial inner membrane and into the mitochondrial matrix. The encoded protein mediates binding of mitochondrial heat shock protein 70 to the translocase of inner mitochondrial membrane 23 (TIM23) complex. Expression of this gene is upregulated in kidney in a mouse model of diabetes. A mutation in this gene is associated with familial oncocytic thyroid carcinoma. [provided by RefSeq, Jul 2016]
Comments
Disease | Target Count | P-value |
---|---|---|
osteosarcoma | 7933 | 2.01192764986302E-5 |
psoriasis | 6685 | 1.3196289061639E-4 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG |
Chicken | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
Zebrafish | OMA Inparanoid |
C. elegans | OMA EggNOG Inparanoid |
Fruitfly | EggNOG Inparanoid |
S.cerevisiae | OMA EggNOG Inparanoid |
MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKSYSSGNRKGFLSGLLDNVKQE 1 - 70 LAKNKEMKESIKKFRDEARRLEESDVLQEARRKYKTIESETVRTSEVLRKKLGELTGTVKESLHEVSKSD 71 - 140 LGRKIKEGVEEAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKR 141 - 210 TEFAGDKFKEEKVFEPNEEALGVVLHKDSKWYQQWKDFKENNVVFNRFFEMKMKYDESDNAFIRASRALT 211 - 280 DKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQ 281 - 350 LAHPIQQAKALGLQFHSRILDIDNVDLAMGKMMEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRML 351 - 420 YVWALCRDQDELNPYAAWRLLDISASSTEQIL 421 - 452 //
PMID | Year | Title |
---|---|---|
26090338 | 2015 | Mitochondrial Ion Channels in Cancer Transformation. |
25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
25749183 | 2015 | Translocase of inner mitochondrial membrane 44 alters the mitochondrial fusion and fission dynamics and protects from type 2 diabetes. |
25666615 | 2015 | The E3 ubiquitin ligase parkin is recruited to the 26 S proteasome via the proteasomal ubiquitin receptor Rpn13. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
21406692 | 2011 | System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. |
21269460 | 2011 | Initial characterization of the human central proteome. |
20877624 | 2010 | Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. |
20471030 | 2010 | Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia. |
More... |