Property Summary

Ligand Count 838
NCBI Gene PubMed Count 65
PubMed Score 26.35
PubTator Score 71.19

Knowledge Summary

Patent (7,542)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Narcolepsy 72 6.395 3.2
Disease Target Count
Insomnia 20
Disease Target Count Z-score Confidence
Acquired immunodeficiency syndrome 197 0.0 2.7
Disease Target Count Z-score Confidence
Cannabis dependence 23 3.51 1.8
Heroin dependence 30 3.033 1.5

Expression

Protein-protein Interaction (1)

Gene RIF (51)

AA Sequence

MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALI      1 - 70
GNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSV     71 - 140
SVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVC    141 - 210
DERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQ    211 - 280
PTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSH    281 - 350
WLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKL    351 - 420
SEQVVLTSISTLPAANGAGPLQNW                                                  421 - 444
//

Text Mined References (66)

PMID Year Title