Property Summary

Ligand Count 529
NCBI Gene PubMed Count 64
PubMed Score 162.05
PubTator Score 70.97

Knowledge Summary

Patent (3,259)

Expression

Gene RIF (55)

AA Sequence

MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLA      1 - 70
VWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFI     71 - 140
ALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDL    141 - 210
YPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRA    211 - 280
RAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYAN    281 - 350
SAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV    351 - 420
TTVLP                                                                     421 - 425
//

Text Mined References (67)

PMID Year Title