Property Summary

NCBI Gene PubMed Count 116
PubMed Score 2001.94
PubTator Score 127.77

Knowledge Summary

Patent

No data available

Expression

Gene RIF (103)

AA Sequence

MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRR      1 - 70
SGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCLGRRCSAPAAASVAPGGQSGI              71 - 131
//

Text Mined References (118)

PMID Year Title