Property Summary

NCBI Gene PubMed Count 105
Grant Count 882
R01 Count 474
Funding $189,729,217.33
PubMed Score 2104.55
PubTator Score 127.77

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O43612
Symbols OX
PPOX
NRCLP1

Gene

PDB

1CQ0   1R02   1UVQ   1WSO  

Gene RIF (92)

PMID Text
27530010 Low circulating Orexin A was found to be significantly associated with hyperlipidemia, obesity and obesity-related disorders in North Indian premenopausal women.
27008404 This is the first time a seasonal variation of hcrt-1 levels has been shown, demonstrating that the hcrt system is, like other neurotransmitter systems, subjected to long term modulation
26831553 Data indicate a positive correlation of nesfatin-1 and a negative correlation of orexin-A with body mass index.
26572581 This study showed that orexin A induced autophagy through the ERK pathway in HCT116 human colon cancer cells.
26555080 Rapid-onset obesity with hypothalamic dysfunction, hypoventilation, and autonomic dysregulation is highly unlikely to be caused by mutations in the exons of the gene for hypocretin.
25957175 Results from homology and docking modeling show two alternative binding modes for orexin-A into orexin 1 receptor in concordance with what is known of G protein coupled receptors activation in general and the mutational data.
25953524 Study shows Ox immunoreactivity is decreased in the hypothalamus and pontine nuclei of infants who died from sudden infant death syndrome
25677777 Data suggest that interaction between the nociceptin/nociceptin receptor system and the orexin/orexin receptor system in neurons of the hypothalamus positively and negatively modulate complex and integrated responses to stress. [REVIEW]
25560205 Patients with schizophrenia had a significantly higher plasma HCRT level than healthy controls. Patients in the high-orexin subgroup had significantly fewer negative and disorganized symptoms, and tended to have fewer perseverative errors.
25515760 Orexin A upregulates the protein expression of OX1R and enhances the proliferation of SGC-7901 gastric cancer cells through the ERK signaling pathway.
More...

AA Sequence

MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRR      1 - 70
SGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCLGRRCSAPAAASVAPGGQSGI              71 - 131
//

Text Mined References (107)

PMID Year Title
27530010 Association of Circulating Orexin-A Level With Metabolic Risk Factors in North Indian Pre Menopausal Women.
27008404 2016 Cerebrospinal Fluid Hypocretin-1 (Orexin-A) Level Fluctuates with Season and Correlates with Day Length.
26831553 2015 Correlation of Brain Neuropeptide (Nesfatin-1 and Orexin-A) Concentrations with Anthropometric and Biochemical Parameters in Malnourished Children.
26572581 2016 Orexin A induces autophagy in HCT-116 human colon cancer cells through the ERK signaling pathway.
26555080 2016 Absence of mutations in HCRT, HCRTR1 and HCRTR2 in patients with ROHHAD.
25957175 2015 Modeling of the OX1R-orexin-A complex suggests two alternative binding modes.
25953524 2015 Decreased orexin (hypocretin) immunoreactivity in the hypothalamus and pontine nuclei in sudden infant death syndrome.
25677777 2015 The neuronal circuit between nociceptin/orphanin FQ and hypocretins/orexins coordinately modulates stress-induced analgesia and anxiety-related behavior.
25560205 2015 Elevated plasma orexin A levels in a subgroup of patients with schizophrenia associated with fewer negative and disorganized symptoms.
25515760 2015 Orexin A upregulates the protein expression of OX1R and enhances the proliferation of SGC-7901 gastric cancer cells through the ERK signaling pathway.
More...