Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.36
PubTator Score 3.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Expression

Synonym

Accession O43610 A8K0H8 Spry-3
Symbols spry-3

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Species Source
Mouse OMA EggNOG
Rat OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
26089202 SPRY3 is a candidate susceptibility locus for autism and related or over-lapping disorders such as ataxia.
16877379 the Sprouty/Caveolin-1 interaction modulates signaling in a growth factor- and Sprouty isoform-specific manner
15950061 Spry 1, 2 and 3 expression was observed in placental tissue from all three trimesters

AA Sequence

MDAAVTDDFQQILPIEQLRSTHASNDYVERPPAPCKQALSSPSLIVQTHKSDWSLATMPTSLPRSLSQCH      1 - 70
QLQPLPQHLSQSSIASSMSHSTTASDQRLLASITPSPSGQSIIRTQPGAGVHPKADGALKGEAEQSAGHP     71 - 140
SEHLFICEECGRCKCVPCTAARPLPSCWLCNQRCLCSAESLLDYGTCLCCVKGLFYHCSTDDEDNCADEP    141 - 210
CSCGPSSCFVRWAAMSLISLFLPCLCCYLPTRGCLHLCQQGYDSLRRPGCRCKRHTNTVCRKISSGSAPF    211 - 280
PKAQEKSV                                                                  281 - 288
//

Text Mined References (13)

PMID Year Title
26089202 2015 Regulation of SPRY3 by X chromosome and PAR2-linked promoters in an autism susceptibility region.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16877379 2006 A functional interaction between sprouty proteins and caveolin-1.
16500999 2006 Maintenance of X- and Y-inactivation of the pseudoautosomal (PAR2) gene SPRY3 is independent from DNA methylation and associated to multiple layers of epigenetic modifications.
15950061 2005 Human placental Hofbauer cells express sprouty proteins: a possible modulating mechanism of villous branching.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391162 2002 The cysteine-rich sprouty translocation domain targets mitogen-activated protein kinase inhibitory proteins to phosphatidylinositol 4,5-bisphosphate in plasma membranes.
More...