Property Summary

NCBI Gene PubMed Count 12
Grant Count 11
R01 Count 10
Funding $997,789.83
PubMed Score 7.36
PubTator Score 3.45

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
26089202 SPRY3 is a candidate susceptibility locus for autism and related or over-lapping disorders such as ataxia.
16877379 the Sprouty/Caveolin-1 interaction modulates signaling in a growth factor- and Sprouty isoform-specific manner
15950061 Spry 1, 2 and 3 expression was observed in placental tissue from all three trimesters

AA Sequence

MDAAVTDDFQQILPIEQLRSTHASNDYVERPPAPCKQALSSPSLIVQTHKSDWSLATMPTSLPRSLSQCH      1 - 70
QLQPLPQHLSQSSIASSMSHSTTASDQRLLASITPSPSGQSIIRTQPGAGVHPKADGALKGEAEQSAGHP     71 - 140
SEHLFICEECGRCKCVPCTAARPLPSCWLCNQRCLCSAESLLDYGTCLCCVKGLFYHCSTDDEDNCADEP    141 - 210
CSCGPSSCFVRWAAMSLISLFLPCLCCYLPTRGCLHLCQQGYDSLRRPGCRCKRHTNTVCRKISSGSAPF    211 - 280
PKAQEKSV                                                                  281 - 288
//

Text Mined References (13)

PMID Year Title
26089202 2015 Regulation of SPRY3 by X chromosome and PAR2-linked promoters in an autism susceptibility region.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16877379 2006 A functional interaction between sprouty proteins and caveolin-1.
16500999 2006 Maintenance of X- and Y-inactivation of the pseudoautosomal (PAR2) gene SPRY3 is independent from DNA methylation and associated to multiple layers of epigenetic modifications.
15950061 2005 Human placental Hofbauer cells express sprouty proteins: a possible modulating mechanism of villous branching.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391162 2002 The cysteine-rich sprouty translocation domain targets mitogen-activated protein kinase inhibitory proteins to phosphatidylinositol 4,5-bisphosphate in plasma membranes.
More...