Property Summary

Ligand Count 29
NCBI Gene PubMed Count 31
PubMed Score 70.37
PubTator Score 51.16

Knowledge Summary

Patent (21,876)

TINX Plot

  Disease (4)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 5.8e-15

Protein-protein Interaction (1)

Gene RIF (15)

AA Sequence

MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTTNLFILNLGVA      1 - 70
DLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPR     71 - 140
NALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWSAPRRRAMDICTFVFSYLLPVLVLGLTYART    141 - 210
LRYLWRAVDPVAAGSGARRAKRKVTRMILIVAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLV    211 - 280
SYANSCVNPIVYALVSKHFRKGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAG    281 - 350
ALRPCPGASQPCILEPCPGPSWQGPKAGDSILTVDVA                                     351 - 387
//

Text Mined References (31)

PMID Year Title