Property Summary

NCBI Gene PubMed Count 30
PubMed Score 67.36
PubTator Score 51.16

Knowledge Summary

Patent (21,876)

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 5.76492553604393E-15
Disease Target Count Z-score Confidence
Epilepsy 346 3.597 1.8
head and neck cancer 270 3.189 1.6

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 0.000

Accession O43603 A5JUU4 Q32MN8 GAL2-R
Symbols GAL2-R

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

  TechDev Info (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay

Gene RIF (14)

26572146 GAL and its receptors, GALR1 and GALR2, play a role in head and neck squamous cell carcinoma tumorigenesis
24706871 Variants in genes for galanin (GAL) and its receptors (GALR1, GALR2, GALR3), despite their disparate genomic loci, conferred increased risk of depression and anxiety in people who experienced childhood adversity or recent negative life events.
24602615 Activation of GalR2 leads to elevation of intracellular Ca(2+) due to Ca(2+) efflux from endoplasmic reticulum through IP3R sequentially opening BK alpha channels.
24568968 The G protein-coupled receptor GALR2 promotes angiogenesis in head and neck cancer
24517231 Data from ligand-receptor interaction studies suggest that human spexin-1 and zebrafish spexin-2 activate galanin receptors GALR2/GALR3 (but not GALR1); thus spexins appear to be natural ligands for human/Xenopus/zebrafish GALR2/GALR3.
24168112 In HEp-2 cells, GALR2-mediated apoptosis was caspase-independent.
24122450 The expression of GALR2 mRNA is lost in head and neck squamous cell carcinoma as a consequence of DNA methylation.Silencing of the GALR2 gene by methylation may be a critical event in head and neck squamous cell carcinoma.
21345369 galanin receptor 2 promotes cell proliferation and survival, and promotes tumor growth, consistent with an oncogenic role for GALR2 in squamous cell carcinoma of the head and neck
19086053 Observational study of gene-disease association. (HuGE Navigator)
18272487 point to GalR2 as a possible target for therapeuthic interventions in pheochromocytoma

AA Sequence

ALRPCPGASQPCILEPCPGPSWQGPKAGDSILTVDVA                                     351 - 387

Text Mined References (30)

PMID Year Title
26572146 2016 Epigenetic inactivation of galanin and GALR1/2 is associated with early recurrence in head and neck cancer.
25691535 2015 Galanin pathogenic mutations in temporal lobe epilepsy.
24706871 2014 Brain galanin system genes interact with life stresses in depression-related phenotypes.
24602615 2014 Activation of galanin receptor 2 stimulates large conductance Ca(2+)-dependent K(+) (BK) channels through the IP3 pathway in human embryonic kidney (HEK293) cells.
24568968 2014 The G protein-coupled receptor GALR2 promotes angiogenesis in head and neck cancer.
24517231 2014 Coevolution of the spexin/galanin/kisspeptin family: Spexin activates galanin receptor type II and III.
24168112 2014 Novel anti-tumor mechanism of galanin receptor type 2 in head and neck squamous cell carcinoma cells.
24122450 2014 Tumor suppressor activity and inactivation of galanin receptor type 2 by aberrant promoter methylation in head and neck cancer.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
23341594 2013 Distinct features of neurotransmitter systems in the human brain with focus on the galanin system in locus coeruleus and dorsal raphe.