Property Summary

NCBI Gene PubMed Count 19
Grant Count 27
R01 Count 16
Funding $4,117,756.93
PubMed Score 171.68
PubTator Score 11.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.300 0.000
posterior fossa group B ependymoma 1.700 0.000
lung cancer 1.600 0.000
ovarian cancer 1.500 0.000

Gene RIF (2)

PMID Text
20962348 analysis of human deoxynucleotide N-hydrolase Rcl and rat gene c6orf108
18726892 characterization of the human Rcl gene, we cloned its promoter, Rcl is a bona fide target gene of ETV1.

AA Sequence

MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAA      1 - 70
GGDRLIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRF     71 - 140
QVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT                                        141 - 174
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25108359 2014 6-(Hetero)Arylpurine nucleotides as inhibitors of the oncogenic target DNPH1: synthesis, structural studies and cytotoxic activities.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24260472 2013 N (6)-substituted AMPs inhibit mammalian deoxynucleotide N-hydrolase DNPH1.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...