Property Summary

NCBI Gene PubMed Count 129
Grant Count 72
R01 Count 47
Funding $4,700,381.79
PubMed Score 81.53
PubTator Score 116.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
psoriasis -1.800 0.000
medulloblastoma -1.900 0.000
astrocytoma 1.100 0.047
glioblastoma 1.500 0.012
medulloblastoma, large-cell -1.800 0.026
adrenocortical carcinoma -1.058 0.025
Hydrolethalus syndrome 1.469 0.042
lung cancer 1.300 0.008
breast carcinoma -2.100 0.000
interstitial cystitis -1.100 0.013
lung adenocarcinoma -1.100 0.000
subependymal giant cell astrocytoma -1.547 0.009
invasive ductal carcinoma -2.700 0.000
Breast cancer -2.800 0.000
lung carcinoma -1.300 0.000
ductal carcinoma in situ -1.700 0.001
ovarian cancer -2.000 0.008
pituitary cancer -1.400 0.001

Synonym

Accession O43597 B2R9J9 Q5T6Z7 Spry-2
Symbols IGAN3
hSPRY2

Gene

PANTHER Protein Class (1)

PDB

3BUM   3OB1  

Gene RIF (110)

PMID Text
26286024 Data show that proto-oncogene protein B-raf (BRAF) inhibition induces c-Jun N-terminal kinase (c-JUN) expression and c-JUN abundance and activation by down-regulating SPRY2/4 protein expression.
26265114 The purpose of this study was to determine whether SPRY2 might have antiinflammatory effects on rheumatoid arthritis fibroblast-like synoviocytes.
26075267 Cosuppression of Sprouty and Sprouty-related negative regulators of FGF signalling in prostate cancer
26026961 A decrease in SPRY2 and RECK expression by nickel-induced miR-21 may promote invasiveness in lung cancer cells.
25934697 SPRY2, counter to its roles in other cancer settings, promotes glioma cell and tumor growth and cellular resistance to targeted inhibitors of oncogenic RTKs
25782674 Arg119Trp variant in the SPRY2 gene was identified as the probable IgA nephropathy-causing mutation. This variant is responsible for inhibition of the MAPK/ERK1/2 pathway.
25633921 miR21 may represent a negative regulator involved in the downregulation of SPRY2 in MM.
25630587 Sprouty 2 protein, but not Sprouty 4, is an independent prognostic biomarker for human epithelial ovarian cancer.
25533808 This study reveals the loss of SPRY2 in HGSC and indicates an important tumor-suppressive role for SPRY2 in mediating the stimulatory effect of EGF on human EOC progression.
25339627 No association between SPRY2, single-nucleotide polymorphisms, and nonsyndromic cleft lip with or without cleft palate risk were observed in this cohort of patients.
More...

AA Sequence

MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPTVVPRPGLKPA      1 - 70
PRPSTQHKHERLHGLPEHRQPPRLQHSQVHSSARAPLSRSISTVSSGSRSSTRTSTSSSSSEQRLLGSSF     71 - 140
SSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQ    141 - 210
NVIDYGTCVCCVKGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQ    211 - 280
GCYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPT                                       281 - 315
//

Text Mined References (133)

PMID Year Title
26286024 2015 The transcription cofactor c-JUN mediates phenotype switching and BRAF inhibitor resistance in melanoma.
26265114 2015 Sprouty2 suppresses the inflammatory responses in rheumatoid arthritis fibroblast-like synoviocytes through regulating the Raf/ERK and PTEN/AKT signals.
26075267 2015 Cosuppression of Sprouty and Sprouty-related negative regulators of FGF signalling in prostate cancer: a working hypothesis.
26026961 2015 Nickel may contribute to EGFR mutation and synergistically promotes tumor invasion in EGFR-mutated lung cancer via nickel-induced microRNA-21 expression.
25934697 2015 Sprouty2 Drives Drug Resistance and Proliferation in Glioblastoma.
25782674 2015 A SPRY2 mutation leading to MAPK/ERK pathway inhibition is associated with an autosomal dominant form of IgA nephropathy.
25633921 2015 Correlation between microRNA?21 and sprouty homolog 2 gene expression in multiple myeloma.
25630587 2015 Sprouty 2 protein, but not Sprouty 4, is an independent prognostic biomarker for human epithelial ovarian cancer.
25533808 2015 Loss of Sprouty2 in human high-grade serous ovarian carcinomas promotes EGF-induced E-cadherin down-regulation and cell invasion.
25416956 2014 A proteome-scale map of the human interactome network.
More...