Property Summary

NCBI Gene PubMed Count 146
PubMed Score 87.64
PubTator Score 116.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.058 2.5e-02
astrocytoma 1.100 4.7e-02
Breast cancer -2.800 8.3e-18
breast carcinoma -2.100 2.6e-07
ductal carcinoma in situ -1.700 1.3e-03
glioblastoma 1.500 1.2e-02
group 4 medulloblastoma -1.900 3.1e-04
Hydrolethalus syndrome 1.469 4.2e-02
interstitial cystitis -1.100 1.3e-02
invasive ductal carcinoma -1.149 1.8e-04
lung adenocarcinoma -1.100 4.5e-12
lung cancer 1.300 8.0e-03
lung carcinoma -1.300 3.2e-12
medulloblastoma, large-cell -1.800 2.6e-02
ovarian cancer -2.000 8.1e-03
pituitary cancer -1.400 5.5e-04
psoriasis -1.400 2.0e-08
subependymal giant cell astrocytoma -1.547 9.4e-03

Protein-protein Interaction (8)

Gene RIF (120)

AA Sequence

MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPTVVPRPGLKPA      1 - 70
PRPSTQHKHERLHGLPEHRQPPRLQHSQVHSSARAPLSRSISTVSSGSRSSTRTSTSSSSSEQRLLGSSF     71 - 140
SSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQ    141 - 210
NVIDYGTCVCCVKGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQ    211 - 280
GCYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPT                                       281 - 315
//

Text Mined References (150)

PMID Year Title