Property Summary

NCBI Gene PubMed Count 41
Grant Count 43
R01 Count 34
Funding $3,281,371.51
PubMed Score 76.96
PubTator Score 44.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.566 0.000
tuberculosis 1.100 0.000
interstitial cystitis 1.400 0.001

Gene RIF (23)

PMID Text
26179737 PSTPIP1 was found to interact with pyrin at the leading edge during cell migration.
26025129 genetic polymorphism is associated with hyperzincemia and hypercalprotectinemia
25486428 Molecular interactions between HPIP and FAK, and HPIP and calpain2 regulate cell adhesion and migration through modulation of focal adhesion dynamics.
25040622 we have shown that PSTPIP1 regulates T-cell activation upon CD3 and CD28 stimulation, independently of CD2 costimulation. PSTPIP1 acts downstream of proximal TCR signaling, inhibiting several transcription factors.
24960411 Case Report: missense mutation in PSTPIP1, the gene responsible for PAPA syndrome.
24421327 PSTPIP1 has a role in the pathogenesis of pyoderma gangrenosum through filopodia formation resulting in extracellular matrix degradation
21790734 novel mutaations found in PSTPIP1 gene in patients with pyoderma gangrenosum
21438098 non-mutated gene and pyoderma gangrenosum in IBD unresponsive to anakinra treatment
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19731031 The CCTG repeat in the PSTPIP1 promoter may play a role in the pathogenesis of aseptic abscess syndrome and Crohn's disease.
More...

AA Sequence

MMPQLQFKDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDMEELLRQRAQAEERYGKELVQIARKAGGQTEI      1 - 70
NSLRASFDSLKQQMENVGSSHIQLALTLREELRSLEEFRERQKEQRKKYEAVMDRVQKSKLSLYKKAMES     71 - 140
KKTYEQKCRDADDAEQAFERISANGHQKQVEKSQNKARQCKDSATEAERVYRQSIAQLEKVRAEWEQEHR    141 - 210
TTCEAFQLQEFDRLTILRNALWVHSNQLSMQCVKDDELYEEVRLTLEGCSIDADIDSFIQAKSTGTEPPA    211 - 280
PVPYQNYYDREVTPLTSSPGIQPSCGMIKRFSGLLHGSPKTTSLAASAASTETLTPTPERNEGVYTAIAV    281 - 350
QEIQGNPASPAQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEKL        351 - 416
//

Text Mined References (44)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26179737 2015 Pyrin-PSTPIP1 colocalises at the leading edge during cell migration.
26025129 2015 Single amino acid charge switch defines clinically distinct proline-serine-threonine phosphatase-interacting protein 1 (PSTPIP1)-associated inflammatory diseases.
25486428 2015 Hematopoietic PBX-interacting protein (HPIP) is over expressed in breast infiltrative ductal carcinoma and regulates cell adhesion and migration through modulation of focal adhesion dynamics.
25416956 2014 A proteome-scale map of the human interactome network.
25040622 2014 Proline-serine-threonine phosphatase interacting protein 1 inhibition of T-cell receptor signaling depends on its SH3 domain.
24960411 A novel de novo PSTPIP1 mutation in a boy with pyogenic arthritis, pyoderma gangrenosum, acne (PAPA) syndrome.
24421327 2014 The F-BAR protein PSTPIP1 controls extracellular matrix degradation and filopodia formation in macrophages.
24407287 2014 Promyelocytic leukemia protein interacts with the apoptosis-associated speck-like protein to limit inflammasome activation.
22161697 2012 Brief report: genotype, phenotype, and clinical course in five patients with PAPA syndrome (pyogenic sterile arthritis, pyoderma gangrenosum, and acne).
More...